KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2678Help
Entry
Lferr_2678        CDS       T00758                                 

Definition
(GenBank) hypothetical protein
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TMEM52
Motif
Other DBs
NCBI-ProteinID: ACH84872
JGI: Lferr2678
UniProt: B5EQH5
Position
complement(2661052..2661396)
Genome map
AA seq 114 aa AA seqDB search
MIKSSAYGVRHLVVVATLALLCGLTSTAVRADDDMSLGLAIPGLSVFLGNGLGYYAPPPP
VYYAPPPRPVYYAPPPPGYYVAPMRARIYERRRWEHRGPPPWAGRWRHDDDWHH
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagtcgtcagcttatggcgtccgccatttggtagttgtcgccaccctggcgctg
ctgtgcggtctgaccagcactgcggttcgggcagacgatgacatgtccctcgggctcgct
attccggggttgagcgtatttcttggcaacggtctgggttactacgccccgcccccaccg
gtctattacgccccgcccccccgccccgtttactatgcgcctccgccccctggctattat
gtggcaccgatgcgtgcccgaatttatgagcgccgccgctgggagcatcgcggacctccg
ccttgggccgggcgctggcggcacgatgatgactggcatcattga

DBGET integrated database retrieval system