KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2680Help
Entry
Lferr_2680        CDS       T00758                                 

Definition
(GenBank) ribosomal protein S9
  KO
K02996  small subunit ribosomal protein S9
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe03010  Ribosome
Module
afe_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:afe00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Lferr_2680
Ribosome [BR:afe03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    Lferr_2680
  Bacteria
    Lferr_2680
  Archaea
    Lferr_2680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S9
Motif
Other DBs
NCBI-ProteinID: ACH84874
JGI: Lferr2680
UniProt: B5EQH7
Position
complement(2662779..2663165)
Genome map
AA seq 128 aa AA seqDB search
MEQYYGTGRRKSATARVYLRRGSGKIVINKRTLEDYFGRETSRMVVMQPLELTGHGGQFD
ILVNVNGGGASGQAGAIRHGITRALMVYDETLRRPLRSAGFVTRDAREVERKKVGKHKAR
RSHQFSKR
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggaacaatattacggtaccggtcggcgtaagagtgcaactgcccgcgtgtatttgcgc
cggggctctggcaagatcgtcatcaacaagcgcaccctggaagactactttggccgtgag
acctcacgcatggtggtcatgcagcccctggaattgaccggtcatggcggccagttcgat
attctggtgaatgtcaacggtggtggtgccagtggtcaggccggggcgatccgccatggc
atcacgcgcgccctcatggtctacgacgaaaccttgcgacgtcccttgcgcagtgctggt
tttgtcacccgcgacgctcgcgaagtggaacggaagaaggtgggcaaacataaggcccgg
cgtagtcaccagttttccaagcgttaa

DBGET integrated database retrieval system