KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2700Help
Entry
Lferr_2700        CDS       T00758                                 

Definition
(GenBank) chaperone DnaJ domain protein
  KO
K05516  
curved DNA-binding protein
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Brite
Chaperones and folding catalysts [BR:afe03110]
 Heat shock proteins
  HSP40 / DNAJ
   Lferr_2700
Chromosome [BR:afe03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    Lferr_2700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2687745..2688677
Genome map
AA seq 310 aa AA seqDB search
MEYKDYYKILGVERSADADAIKASYRKMARKYHPDVSKERDAEERFKDLQEAYEVLKDPE
KRAAYDQLGSNWRAGQEFRPPPGWGQAAGGGFGGGGGGFSDFFESIFRQQGGGFGSGGAS
GFRSQGEDSEATIRVSLEDAAHGAQREISLEVPTMGPDGRMRREARRLTVKIPKGIREGQ
RLRMAGQGAPGMGGGPNGDLYLHIQFLPHPRFRIEGSDLYHDLHITPWEAVLGASVEVPT
LDGDVRMKIPAGSTSGQKLRLSQKGLPGAGSKPPGDLYAVIQIVVPKKISEPEKALWNQL
AEMSDFHPRR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
ttggaatacaaggactactacaaaattctgggagtcgaacgcagcgccgatgccgatgcc
atcaaagcgtcttatcgcaaaatggcgcgcaaatatcacccggatgtgagtaaggaaagg
gatgcggaggaacgcttcaaggacctccaggaagcctacgaggtgctcaaggacccggag
aaacgcgccgcctatgaccagttgggcagcaactggcgcgccggccaggagttccggccc
ccgcccggttggggtcaggcggccgggggtggctttggcgggggtggcggcgggttcagc
gactttttcgagtccatattccgccagcagggtggtggcttcggaagcggcggggcgagc
ggattccgcagccagggcgaagatagcgaggcgacgatccgcgtcagcctagaggatgcg
gcccacggcgcccaacgtgagatcagcctggaagtacccaccatgggtcccgatggccgt
atgcgccgtgaagcgcggcgcctgaccgtcaagatccccaaaggcatccgcgaagggcag
cgactgcgtatggcggggcagggtgcgccgggtatgggtggcggtcccaatggggatctg
tacctgcacatccagtttctgccacaccccagatttcggatagagggcagtgatttatat
catgacctgcacatcactccgtgggaggcggtgctcggcgccagcgtcgaagttcccacc
ctggatggcgacgtgcgcatgaagattccggccggtagcaccagcgggcagaagctgcga
ctcagtcaaaagggattgccgggcgccggcagtaaaccacctggagatttgtatgccgta
atccagattgtcgtccccaaaaaaatcagcgaaccggaaaaagccctgtggaaccaactg
gcagagatgtccgacttccatccccgccgctga

DBGET integrated database retrieval system