KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2703Help
Entry
Lferr_2703        CDS       T00758                                 

Definition
(GenBank) PHP domain protein
  KO
K02347  
DNA polymerase (family X)
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Brite
DNA repair and recombination proteins [BR:afe03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   DNA polymerase
    Lferr_2703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2689667..2691397
Genome map
AA seq 576 aa AA seqDB search
MPVLNPDIARAFDEIADLLEIEDANPFRVRAYRTAARLVLGLSSDLKTMVEAGEDLTELP
GIGEDLAKKIIEIVTTGHCSFLEKLEKQTPPALTELLKVPGLGPKRVKALWHELDVETVD
QLTRAAREGRIRSIPGFGEKTEARILEALQAQIAAVPRFPIAVAAPYAAALVRYLQNVPG
VRRVVVAGSFRRGRDTVGDLDILATATADSPVMERFTAYEDVAEVFSQGTTRATVILRNK
LQVDLRAVDESSYGAALHYFTGSKSHNIAIRRMGQDMGLKVNEYGLFRGKERIAGDTEES
VYAAVGLPYIEPELRENRGEIQAARAGHLPKLVAMGDLRGDLHAHSKASDGHYSMRDMAA
AARAAGLEYLAITEHSRHLTVAHGLDPVRLRRQMDEIDALNTELDGITLLKGIEVDILED
GSLDLPDGILSDLDLVVAAVHYRFDLPRNKQTARILKAMDSPHFTILAHPSGRLIGSREP
MDVDMPRIIRHARERGCFLEIDAQPERLDLVDIHARTAKEEGVLLAVNSDAHSIHDFDNL
RFGLQQAQRGWLEMKDVLNTRTLEELRPLLAATMSR
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgcccgttctcaaccccgacatcgcgcgcgcattcgacgaaatcgctgatcttctggag
atcgaggatgccaaccccttccgggtacgggcataccgcaccgccgcccgcctcgtgctg
gggctgagcagcgacctcaagaccatggtggaggctggagaggatctcaccgagctgccc
ggcatcggcgaggatctagccaaaaaaattatcgagatcgtcaccacgggacactgctcc
ttcctcgaaaaactggaaaaacagaccccgcccgcgctgacggagctgctcaaggtgccg
ggtcttggacccaagcgggtcaaggcgctttggcacgaactggacgtggaaaccgtggac
cagctcacccgcgccgccagagaggggcgcattcgcagtatccccggttttggggagaaa
accgaagcgcgcatcctggaagccctccaggcccagatcgccgccgttccccgttttccc
atcgccgtcgccgccccgtatgccgctgccctggtccgctatctgcagaacgtacccggt
gtgcggcgggtggtggtggccggcagcttccgacgcggcagggatacggtgggcgacctg
gatatactggctacggccactgcagacagcccggtcatggaacgcttcaccgcctatgag
gatgtggcggaagtgttctcccagggtaccacccgagccaccgtgatcctgcgaaacaag
ctccaggtggacctgcgcgccgtggacgaatcctcctatggtgccgccctgcattatttt
accggctccaagtcccacaacatcgccatccgccgcatgggtcaggacatgggtttgaaa
gtcaacgaatatgggctttttcgcggaaaggaacggattgccggcgatacggaggagtcg
gtctacgccgctgtcggcctgccctatatcgagccggaattgcgggagaaccgcggcgag
atccaggccgcccgcgccggacatctgccgaaactggtggcgatgggcgatttacgcggt
gaccttcacgcccacagcaaggccagcgatggccactatagtatgcgggacatggctgcg
gcggcccgggccgcgggtctggaatatctggctatcaccgagcacagccgccacctgacc
gtcgcccatggcctcgacccggtgcgtttgcgtcggcagatggacgagatcgatgccctc
aataccgaactcgatggtatcacgctcctcaagggcatagaggtcgacatcctggaagac
ggcagcctggatttacccgacggcatcctgtctgatctggacctggtagtggctgccgtg
cattaccgcttcgacctgcccaggaacaaacagaccgcacgcatcctcaaggccatggac
agcccccatttcaccatcctcgcccaccccagcgggcgactcatcggcagccgggaaccc
atggatgtcgacatgccccgcatcatccgccatgcgcgcgagcggggatgctttctggag
atcgatgcccagcccgagcggctggatctcgtcgatatccatgcgcggacggccaaggaa
gaaggagtgctgctggccgtcaattccgacgcccacagtattcacgacttcgacaacctg
cgttttggcctgcagcaggcgcagcgcggctggctggagatgaaggacgtgctcaatacg
agaacgctcgaggagttgcggcccctgctggcagcgaccatgagccggtag

DBGET integrated database retrieval system