KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2711Help
Entry
Lferr_2711        CDS       T00758                                 

Definition
(GenBank) cytochrome c-type biogenesis protein CcsB
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C_asm
Motif
Other DBs
NCBI-ProteinID: ACH84903
JGI: Lferr2711
UniProt: B5EQK6
Position
2699076..2700263
Genome map
AA seq 395 aa AA seqDB search
MASSQADESLALTKMEAEGHWVNRISKQDLLWFAGLTVAAGVLVDVFNSQFWFWQYVVLA
TWYVTLVAVGIHWRAFQVAFLTVVSAALLGVWLYSIGQTPANDVILCYVLQGYAGVMWMI
GFLLAATSAYIIYLFTLSEKVGRLATGLTWVGVIMGFIGLGVRWRETYIGHPDWGHVPVT
NLWEVMVVFCAATALFYLYYESRFKSRSLGAFVMPLVAAAAGFLIWLTFVQHMDRIAPII
PALQSFWMKLHVPMMFVAYANFTIASLVGLAYLLGDRSRRSGGGGVLARALPSGEVMDNM
MSKAIALGFLLFTIATILGAVWAAKAWGGFWSWDPKETWALIVWLNYAGYLHARTSKGWR
GKQMAWWSFMSLWVVTFCFLGVNLFLSGLHSYGKL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggctagctcacaagcagatgagtcgctcgcgcttacgaaaatggaagccgagggacat
tgggtgaatcgtatcagcaagcaggacctgctgtggttcgcggggcttacggttgctgct
ggtgttttggtggacgtttttaacagccagttttggttttggcaatatgtggttcttgct
acctggtatgtcacgttggttgcagtcggtattcactggcgcgccttccaggtggcattc
ttaacggtggtcagcgccgctcttctgggtgtttggttgtatagcatcggccaaacacct
gctaacgatgtcattttatgttacgtattacaaggctatgccggtgttatgtggatgatc
ggttttcttttggccgccaccagtgcttatattatctacctgtttaccctctcggaaaaa
gtggggcgcttggcaacggggctgacatgggtcggtgttattatgggcttcatcggcctt
ggtgtccgttggcgcgaaacctatatcgggcatcctgattggggacatgttccggtgacc
aatctttgggaggtgatggtggtattttgcgcagccactgccctcttttacctttattat
gagtcccgcttcaaatccagatcgctaggggcttttgtcatgcccttggttgcggcggct
gcagggttccttatctggctgacctttgtccagcatatggatcgtatagcaccgataatt
cctgcgctacaaagcttctggatgaaattgcacgtaccgatgatgtttgtggcatatgcc
aacttcaccatcgccagtctggttggtctcgcttatcttctcggcgaccgctcgcgtaga
agtggtggcggcggcgttctcgcgcgggctcttcccagcggggaggttatggataacatg
atgtccaaggcaattgccttgggatttctgttgtttacgatcgccactatcctcggtgct
gtatgggccgccaaggcatggggcggattttggtcgtgggatcccaaggagacgtgggca
cttatagtttggttgaattatgccggataccttcatgcccgtacaagtaaaggatggcgg
ggcaagcagatggcgtggtggtcctttatgagtctgtgggttgtgacattctgctttctg
ggcgtcaacctctttctatccgggttgcattcttacgggaagctctga

DBGET integrated database retrieval system