KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2735Help
Entry
Lferr_2735        CDS       T00758                                 

Definition
(GenBank) integral membrane sensor signal transduction histidine kinase
  KO
K15011  
two-component system, sensor histidine kinase RegB [EC:2.7.13.3]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
Two-component system
Module
RegB-RegA (redox response) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:afe00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Lferr_2735
Enzymes [BR:afe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Lferr_2735
Protein kinases [BR:afe01001]
 Histidine protein kinases
  Other families
   Lferr_2735
Two-component system [BR:afe02022]
 Other families
  RegB-RegA [MD:M00523]
   Lferr_2735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2721519..2722793
Genome map
AA seq 424 aa AA seqDB search
MHSTNHAMSHGALNLQRVLLLRGMAVIGQCMAIAVVTIILKWHIPIWHLAAVVAIEILLT
MATTVRLTFQWPISNHEFFAQILADVAILVALLYFSGGPTNPFIALLLLPLVITVATLPK
IYGWSMAAITVLCYSGLMASYVPLPLHALATYEMKLHIWGMWFEFIIIAGAISYFVKRMS
DSLQERDQAIAHAREEKLMMDRVVDLGALAAGVAHELGTPLATMTIITKDLQQDYKETQN
LSESLGILYEQLQRCKRILSTMSASAGQLQASSGCQLRIEEYLNDIITKWGDARPGIHVE
FRSDGSGSTAKIVAEHTLTQALTNIFNNAADESPDYVEIDVHCSDHDVVIDVCDLGRGVT
PEIARDVGQPFVSKKEDGLGLGLFLATTIINRLGGSVSLFSRREGGSCTRVVFPLTSLLI
STNN
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcattccactaaccacgccatgtctcatggcgccttgaacctccagcgcgttttgctg
ctacgcggaatggctgtcatcggccaatgcatggccatagccgtggttacgatcattctc
aaatggcacatacccatatggcatttggcggcggtagtcgccatagaaatactcctgaca
atggccaccactgttcgccttactttccagtggcctatcagcaaccatgagttctttgcg
cagatcctggccgatgttgccattctggtggccctcctatatttttccgggggccctacc
aatccatttatcgccttactgttgttaccattagttattaccgttgccacccttccaaaa
atatacgggtggtcaatggcggcgataaccgtattgtgctattcaggattgatggcttct
tatgtaccgctaccactacatgctcttgccacatacgaaatgaagttgcacatatggggg
atgtggtttgaatttattataattgccggcgctatcagctatttcgtcaaacgcatgagc
gacagcctgcaggaacgggatcaggctatcgcccatgcgcgcgaagaaaaactgatgatg
gatcgcgttgttgacctaggtgctttggcggccggtgttgctcatgagctggggacgcct
ctcgccactatgacgataataaccaaggacctgcagcaggactataaagaaacccagaat
ctttcggaaagtctgggtattttgtatgaacagctgcagcggtgtaaacgcattctcagc
acaatgtctgcttccgctggccagttgcaggcatcgagcggttgccagctacgcatcgaa
gaatacctcaatgatatcattaccaaatggggcgatgctcgtccgggtattcacgtcgaa
tttcgttcagatggctccggatcgactgcaaaaattgttgcggagcataccttgactcag
gcgctaaccaacattttcaataacgccgccgacgaatcgcctgattatgtagaaatagat
gtacactgtagcgatcacgatgtcgtcattgatgtctgcgatcttggtcgcggggtcact
ccggagatagccagggatgtgggacaaccttttgtctctaaaaaagaagatggtcttggt
cttgggctttttttagcgactaccattataaaccgtttgggtgggagcgtctccctgttc
agccggagagagggaggatcctgtacccgtgtggtatttcccctgacctcattactgata
agtaccaacaactaa

DBGET integrated database retrieval system