KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2743Help
Entry
Lferr_2743        CDS       T00758                                 

Definition
(GenBank) rusticyanin
  KO
K18683  
rusticyanin
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2728701..2729264)
Genome map
AA seq 187 aa AA seqDB search
MYTQNTMKKNWYVTVGAAAALAATVGMGTAMAGTLDTTWKEATLPQVKAMLEKDTGKVSG
DTVTYSGKTVHVVAAAVLPGFPFPSFEVHDKKNPTLEIPAGATVDVTFINTNKGFGHSFD
ITKKGPPYAVMPVIDPIVAGTGFSPVPKDGKFGYTDFTWHPTAGTYYYVCQIPGHAATGM
FGKIVVK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgtatacacagaacacgatgaaaaagaactggtatgtaactgttggtgcggctgcggct
ctggcggcaacggtcggcatgggcaccgcgatggccggtactctggataccacatggaaa
gaggcgacgcttccccaagtaaaggccatgttggagaaagacaccgggaaagtcagtggt
gacactgttacctacagtggcaagactgtacatgtggtcgcggcggccgtgctcccggga
tttccatttccgagttttgaagttcatgacaaaaagaacccgaccttggagattcccgcg
ggggcaacggtggacgtgaccttcattaacaccaacaagggattcggtcatagttttgac
atcaccaaaaaaggacctccttatgcggttatgccggtgatcgaccccattgttgcagga
acaggattcagtccggtcccaaaagatggcaagttcggatatacggattttacctggcat
ccgacggcgggcacttactactacgtatgtcagataccggggcatgccgccaccggtatg
ttcggtaagatcgttgtcaagtaa

DBGET integrated database retrieval system