KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2745Help
Entry
Lferr_2745        CDS       T00758                                 

Definition
(GenBank) hypothetical protein
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2729632..2729826)
Genome map
AA seq 64 aa AA seqDB search
MDMSHLSFVIPSGADNPTFFWLTGYIGFPVVFLSAYFWWVLKEAGKEDRLRILKKGENGA
SSNA
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atggatatgtcacatttatcgttcgttatcccgtccggagctgataatccgacgttcttc
tggctgacggggtacattgggtttcctgtagtgtttcttagtgcatacttttggtgggta
ttaaaggaggcaggcaaggaagatcggctgcgtattctaaaaaagggagaaaacggcgca
tctagcaacgcatga

DBGET integrated database retrieval system