KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2750Help
Entry
Lferr_2750        CDS       T00758                                 

Definition
(GenBank) cytochrome c class I
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 DUF1924 TruB_N
Motif
Other DBs
NCBI-ProteinID: ACH84942
JGI: Lferr2750
UniProt: B5EQZ1
Structure
PDB: 

Jmol
Position
complement(2733813..2734505)
Genome map
AA seq 230 aa AA seqDB search
MTTYLSQDRLRNKENDTMTHPHSKMYKSKTFLLFSALLLVAGQASAAVGSADAPAPYRVS
SDCMVCHGMTGRDTLYPIVPRLAGQHKSYLEAQLKAYKDHSRADQNGEIYMWPVAQALDS
AKITALADYFNAQKPPMQSSGIKHAGVKEGKAIFNQGVTNEQIPACMECHGSAGQGAGPF
PRLAGQRYGYIIQQLTYFHNGTRVNTLMNQIAKNITVAQMKDVAAYLSSL
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgacgacatacttaagccaagaccggttgcgcaataaagagaacgacacgatgacccat
ccacatagcaagatgtataagtcgaaaaccttcctcctgttcagcgcactcctgctggtg
gccgggcaggcgagtgctgccgtcggcagcgccgacgcgccggcgccataccgcgtttcc
agcgattgtatggtgtgccacgggatgactggccgtgacacactttacccgatcgtcccc
cgcttggccggacagcataaaagttatctggaggcgcagttgaaagcgtataaggaccac
tcccgtgccgatcagaatggcgaaatctacatgtggcccgtggcacaagcgctggacagt
gcgaaaatcacggcgctggcggattacttcaacgcccagaagccgccgatgcaaagcagc
ggcatcaagcatgccggtgtgaaagaaggaaaggccatattcaaccaaggggttaccaac
gaacaaatccctgcctgcatggaatgccacggatcggctggccaaggagcgggcccgttc
ccccgcttggcgggccagcgttacggttacatcattcagcagttgacctacttccacaac
ggcacacgggttaataccctgatgaatcagattgcgaagaatatcaccgtggcgcagatg
aaggatgtggcggcttatctttcatcgttgtaa

DBGET integrated database retrieval system