KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2757Help
Entry
Lferr_2757        CDS       T00758                                 

Definition
(GenBank) D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
  KO
K03778  D-lactate dehydrogenase [EC:1.1.1.28]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe00620  Pyruvate metabolism
afe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Lferr_2757
Enzymes [BR:afe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.28  D-lactate dehydrogenase
     Lferr_2757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 XdhC_C Rossmann-like F420_oxidored Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ACH84948
JGI: Lferr2757
UniProt: B5EQZ7
Position
complement(2742201..2743196)
Genome map
AA seq 331 aa AA seqDB search
MRCLVTSARPYDEQFLSAANHGRHELVFVETALSADTAFIAQGYPAICPFVDDTLDAKTL
ETIARLGTKLLVLRSTGFNHVDMPAAEKYGITVMRVRDYSPYAVAEYAVGLMLTLNRHLH
KAYNRVRDGNFLLDGLLGFDMHGKTVGIIGTGKIGQALARILHGMGCHLLGYDTVANPAC
LELGVAYVPLEELLVKSQIVSLHVPLLPETRHLMNAERFALMPDGAMLINTSRGPLIDTT
ALIAALKSRHLGAVGLDVYEEEAELYFKDHCDDIICDDSFERLLTFPNVIITGHQAFFTS
EALTTIARTTIQNLDDYSDGKDNPNCVRSKG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcgttgtctggtgaccagtgctcgcccttacgatgaacaattcctcagcgccgccaac
catggacgccacgaattggtatttgttgaaaccgcactgagcgcggatacggcttttatt
gcccagggataccctgccatttgccccttcgtggatgacacgctggacgcaaaaacactg
gaaaccatagcgcgcttggggactaaactactggtcttgcgcagcaccgggttcaatcat
gtggacatgcctgcggccgagaagtacggcatcaccgtcatgcgggtacgcgattattcc
ccttatgcggtggctgaatatgccgtcggcctgatgttgaccctgaaccgacacctgcat
aaagcctataaccgggtgcgtgacggtaattttctcctcgacggcttgctgggttttgac
atgcatggcaaaaccgtaggcattatcggcactggaaaaattggccaggcactcgcccgg
attctgcatggtatgggctgccacttgttgggctacgacacagtcgccaatcccgcgtgc
ctggaactcggcgttgcatatgtaccgctggaagaattgctcgtcaaaagccaaatcgtc
agcctccatgtgccgctgctcccggaaacccggcatctgatgaatgcggaacggttcgcc
ttgatgccggacggtgccatgctgatcaataccagccgtggtccgctcatcgacaccacg
gcactcattgcggcactgaaaagccgccatctgggtgctgtgggtctggatgtctatgaa
gaagaggcagaattatattttaaggatcattgcgatgacattatctgcgatgacagcttc
gaacggctgctcacttttcccaatgtcatcatcacgggccatcaggccttttttaccagt
gaggcactgaccaccattgccaggaccacgatccagaacctggatgactacagcgatgga
aaggataatcccaattgcgttcgcagcaagggatga

DBGET integrated database retrieval system