KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2764Help
Entry
Lferr_2764        CDS       T00758                                 

Definition
(GenBank) Transglutaminase-like protein protein-like protein
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transglut_core
Motif
Other DBs
NCBI-ProteinID: ACH84955
JGI: Lferr2764
UniProt: B5ER04
Position
complement(2748067..2748714)
Genome map
AA seq 215 aa AA seqDB search
MKLAKFDTQPLPHFLMESATVDYAHADIRKLAAALSSDDSTATARHCFEWVRDHIEHSMD
FHREEVTCAASDVLQQGTGLCTAKSHLLVALWRANQIPAGFCYQRLTLDGPNPPYCTHGF
TAVWLNGRGWYRCDARGNSKPGIRCEFTPGQENLAFSSRYDGERTYPEVWAEPWPDLLTA
MEKLQNISQYRSHPIDARPPAADLCVSESAAPNME
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcgcaaaattcgatacccagccgttaccgcacttcctgatggaaagtgccacc
gtagattatgcgcatgccgatatccgtaagttggcggccgccttatcctctgacgattca
acggcaaccgccaggcattgcttcgaatgggtacgcgatcacatcgaacacagcatggat
tttcaccgggaagaagtgacctgcgcagcgtcggatgtgttgcagcaaggcactggccta
tgcaccgcgaaaagtcatctgctcgtggccttatggcgcgccaaccaaatccctgcggga
ttctgttatcaacgactgacgctggatggccccaatccgccctactgtacacacggcttc
actgcggtctggctgaatggccggggctggtatcgttgtgatgcgcgcggcaacagcaaa
cccgggatccgctgcgaattcacgcccggccaagaaaatcttgctttctcgtcgaggtat
gacggcgagcggacctatccggaggtttgggcagagccctggccagacttgctcaccgcc
atggaaaaactgcaaaacatatcgcagtatcggagccatcccattgatgcccgcccaccc
gccgcagatttgtgcgtaagtgagtctgcagcgccgaacatggaatga

DBGET integrated database retrieval system