KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2774Help
Entry
Lferr_2774        CDS       T00758                                 

Definition
(GenBank) conserved hypothetical protein
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2755114..2755863
Genome map
AA seq 249 aa AA seqDB search
MYFLLIDLLEFKNLGQFEKLAWSVPVDYKGKAFLIEHRKFGIGIFVDNPQAHETEAAEIA
TRIQKATKVARPYFEWRAESAVADSKLNVKNYTDELHQRFQYVYGEYQKIVADIRREEER
RRSLSREERMSDWDGYFSEPYTLTEKAAWLASAAIDAFFSFTEHVFIHLAILQGTISTGN
EVASLASADWGNKFKAVFDLQEPTSKRFYDDLTEIRRQHRNFVAHGSFCSTSIILTHRRQ
LPWPVSEGP
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtgtattttctgctgatcgacctattggagtttaagaaccttggccagttcgaaaagcta
gcttggtctgttcccgtagactacaagggcaaggcgtttctcatcgaacatagaaagttt
gggataggcatctttgtagacaatccacaggcacacgagacagaagcggcagaaatcgcg
acacgcattcaaaaggctacaaaggtggcacggccctacttcgagtggcgcgccgagagc
gctgtggccgattcgaaactcaatgtcaagaactacaccgacgaacttcaccagcgtttt
cagtacgtttatggtgaatatcaaaagatagtggccgatattcggcgtgaggaagaacgg
aggaggagtctttcacgcgaggaacggatgtcagattgggatggctatttttccgagccc
tacacgctcacagaaaaggctgcttggctagcgagtgcggctatcgatgcattcttcagt
ttcaccgagcatgtattcattcatctcgcgatacttcaagggacaattagcacggggaac
gaggtcgcatctctagctagcgctgattggggcaataaattcaaagccgtctttgatctc
caagagcctacatcaaagcgcttctatgacgacctgaccgagattagaagacagcatcga
aacttcgtcgcacatgggtcgttctgctcgacgtcaattatcttgacccatcggcgacaa
ttaccttggccggtgagtgagggaccctaa

DBGET integrated database retrieval system