KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2787Help
Entry
Lferr_2787        CDS       T00758                                 

Definition
(GenBank) hypothetical protein
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: KfrA_N
Motif
Other DBs
NCBI-ProteinID: ACH84973
JGI: Lferr2787
UniProt: B5ER22
Position
2764687..2764959
Genome map
AA seq 90 aa AA seqDB search
MCRRVGGPGIQGINIHAALVRQYGFGGSYSAVERLIRQIRAAAPPRVTSRLTFAPGEAAQ
VDFGAGPLLADPLGSEGDDFVALARREVGW
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtcgccgcgtgggtggcccaggtatccaggggatcaacatccatgcggccctggtg
cggcagtacggcttcggcggcagctattccgccgtcgagcggctgattcgccagattcgt
gccgccgcaccgccgcgcgtcacctcccggttgaccttcgccccgggtgaggccgcccag
gtggatttcggcgcgggcccgctgctggctgatcctctgggatcagaaggtgatgacttc
gtcgcattggcgcgccgcgaggtagggtggtga

DBGET integrated database retrieval system