KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2789Help
Entry
Lferr_2789        CDS       T00758                                 

Definition
(GenBank) transposase, IS4
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_1 Elong_Iki1
Motif
Other DBs
NCBI-ProteinID: ACH84975
JGI: Lferr2789
UniProt: B5EK19
Position
2767159..2767473
Genome map
AA seq 104 aa AA seqDB search
MKDGTLREDCAFGLTSLTKDRTTPENLLGIARGHWEIENRNHHVRDTTYHEDLSQIRTEN
GPHMMATLRGLAMSILRLIGVKNIAQAGRDFAASARKTLRQFGY
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacggcacccttcgtgaagattgcgctttcggactcaccagcctcaccaaagat
cggacgactcctgaaaatctgctgggcatcgcccggggccattgggagatcgaaaaccgc
aaccatcatgtccgcgataccacctatcacgaagacctctctcaaatccggaccgaaaac
ggaccacatatgatggcgactctacgtggcctcgccatgagcatcctgcgtctcatcggg
gtgaaaaacatcgcccaggctggccgtgacttcgccgccagcgctcgcaaaacactccgc
cagttcggttactga

DBGET integrated database retrieval system