KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2793Help
Entry
Lferr_2793        CDS       T00758                                 

Definition
(GenBank) DNA methylase N-4/N-6 domain protein
  KO
K00571  
site-specific DNA-methyltransferase (adenine-specific) [EC:2.1.1.72]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Brite
Enzymes [BR:afe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.72  site-specific DNA-methyltransferase (adenine-specific)
     Lferr_2793
Prokaryotic defense system [BR:afe02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   DNA methyltransferases
    Lferr_2793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2772175..2774430
Genome map
AA seq 751 aa AA seqDB search
MAKQDKKAYDLSEAEQRDLVTLIQQGKALPEKYRFILFEDKREVELVWNGKTRDVCTTVL
PFQTLEHVDEPRAETKTQGDLFDPRGRQVRGWTNKLIWGDNKLILSSLKSGALRRQIEDA
GGLKLIYIDPPFDVGADFSMDVEIGGETFHKEANLLEQIAYRDTWGRGADSFISMIYERL
ILMRDLMAEDGSIYVHCDWRLASLVRIALDEVFGKGGDNEAPGFRNEIIWYFSQGGKGVK
HWARKHNTILYYSKTDSPIFNQDAVRLPFTPHKQDEKGENYGGRMGVDEDGRRYVEKWGT
GKKKLYRYYLDEGKLPEDVWTDIQSIQSAATERMDYPTQKPEALLERIIKASSKEGDLVA
DFFVGSGTTAAVAEKLGRKWIATDLGKFGIHTTRKRLIGVQREKKAAEQDFRAFEVLNLG
RYERQAYLNVGGRLSGEQKAQALTQKENEFRDLILRAYKATEFGGTEGTQAQDGFFHGAR
NGRLVVIGPINLPVGRLFVEEVITECRKRGASRVDVLAFEFEMGLFPAVLEEARGKGIDL
APKYIPAEVFDKRAIDKGQVVFHDISFVEATPRYDKKNKFAVTIELTDFSVYYTQGAAEA
AIAAMKEGKSEVMCEQGQLYKVSKNKEGIVTKARLTKHWTDWVDYWAVDFDYMSRREIIK
VPVGTGLSGVASLLGIEPPQDELITQEFEERWTGGYIFENEWQSFRTRQNRDLELATAVH
TYDRPGRYTVAVKVIDIFGNDTMTLVPVNIG
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacaagacaagaaagcctacgacctgagcgaagccgaacaacgcgacctggtg
accctgatccagcaaggcaaggccctgccggagaaataccgcttcatcctgttcgaggac
aagcgcgaggtcgagctggtgtggaacggcaagacgcgggacgtgtgcaccacggtgctg
cccttccagaccctggagcatgtggacgagccgcgcgccgagactaaaacccagggagat
ctgttcgacccgcgcggccgccaggtcaggggttggaccaataagctgatctggggcgac
aacaagctgattctctcctcgctcaagagcggcgcgctgcgccgccagatcgaggacgcg
ggcggcttgaagctgatctacatcgacccaccattcgatgtcggcgcggatttcagcatg
gatgtcgagatcggcggtgagaccttccacaaggaagcgaacttactcgagcaaatcgcc
taccgcgatacttgggggcggggggcggatagtttcatttcaatgatctatgagcgcctg
atcctcatgcgcgatctgatggcagaggacgggagcatctatgtgcattgcgattggcga
ctggcaagtcttgtccgtatcgcattagatgaagtatttgggaaaggaggcgataacgaa
gctcctggatttcggaacgagatcatttggtacttcagtcaaggtggaaagggggtaaag
cactgggcgcgaaaacacaataccatcctttattattctaagactgattctcctatcttt
aaccaagatgcggtcagacttccgtttactccacataagcaggatgagaagggcgagaac
tatggcgggcgtatgggcgttgacgaggacggacggcgttacgtagaaaagtggggaact
gggaagaagaagctatatcggtactacctggatgaaggcaaattacccgaggatgtttgg
accgacattcagtctattcagtctgcggcaactgaacgcatggactacccgactcaaaag
ccggaagcccttctcgagcgcattatcaaggctagtagtaaagaaggagatttggttgcc
gattttttcgttggttccggcacgaccgctgccgtcgccgaaaaattggggcgcaaatgg
attgccaccgatcttgggaaattcggtatccatacgacccgcaaacggctcatcggtgta
caacgcgagaaaaaggccgccgaacaagacttccgtgcttttgaggtgttgaaccttggc
cgctacgagcgccaagcctacttgaatgtcggtgggcggctctcaggcgaacagaaggcc
caagccctcacccagaaagaaaacgagttccgcgacctgatcttgcgcgcctacaaggcc
acagaatttggcggcaccgaaggcacgcaggcgcaggacggctttttccacggcgcgcgc
aatggccggctggtggtgatcgggccgatcaacctgcccgtgggtcggctgttcgttgag
gaagtcattaccgagtgccgcaagcgcggtgcttcgcgtgtagacgtgctggccttcgag
ttcgagatggggttgtttccggccgtgcttgaggaagcgcgtggcaagggcatcgacctg
gccccgaaatacattcccgccgaggtgttcgacaagcgggccatcgacaagggtcaggtg
gtgttccacgacatcagcttcgtcgaagccacgccgcgctacgacaagaagaacaagttc
gcggtcaccattgagctaacggatttctcggtctattacacccagggcgccgccgaggcc
gcgattgccgccatgaaggaaggcaagagcgaggtcatgtgcgaacagggtcagctctac
aaggtgagcaagaacaaagaagggatcgtcaccaaggcgcgcctgaccaagcactggacg
gactgggtggattactgggcggtggatttcgactatatgagccgcagagaaatcatcaag
gtgccagtgggcaccggcctcagtggagtcgcctcactgctaggcattgaaccgccgcaa
gacgaactgattacgcaggaattcgaggagcgctggacgggcggctacatcttcgagaat
gaatggcagagcttccgcacccgccagaatcgcgacctggagctggcaacggccgtgcat
acttatgaccggccggggcgctacaccgtagctgtcaaggtaatcgatattttcggcaat
gacacgatgacgctcgtgccagtgaacattggttaa

DBGET integrated database retrieval system