KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2796Help
Entry
Lferr_2796        CDS       T00758                                 

Definition
(GenBank) hypothetical protein
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2778421..2779269)
Genome map
AA seq 282 aa AA seqDB search
MPKSQPKRRGPDGGPSSGDVPVIDTVGSGSRTDVHQPALPILTRTSIFDREIEVRRVDKK
DRVRVIRRRNKGAAGTSENEGKTRKYRGSGKTPPPKVSVSPESLHDDLLPMEFQVLAVEK
GEGTDDLRRLMQVIRTMAHGLIDVRVLTALCRLETGQAFSMVGKRQRLCLVAVFFQKKTF
PVVLLDVEHSNIMALSTLLLRFKGSIGLRDIENHILLILHRLDCRGGRWDVTENEGDQLA
QYERLRKVMRPDPGGNEQQQNGVWAAKLRKKLFEAPGPSAST
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaagtcagcccaaaaggcgtggaccagacggtgggccgtcatccggtgacgtt
cctgtcatagacacggtaggttcgggtagtaggacggatgttcatcagccagccctgccg
atattgaccagaaccagcatttttgaccgggaaatcgaagtgcgtcgggtggataaaaaa
gatcgggtacgtgttatcaggcgtagaaacaagggtgctgcgggtaccagtgaaaatgag
ggaaagacccgaaaatatcggggaagtggaaaaaccccaccgcctaaagtgagcgtttcc
cctgagtctctgcacgacgatctcctgcccatggagtttcaggtgcttgcggtcgagaaa
ggtgaaggtacggacgatctaaggcgattgatgcaggtgatccggaccatggcgcacggg
ttaatagatgtccgtgttttgacggcgctgtgtcggcttgaaaccgggcaggccttttcc
atggttggaaagcgccaaagattatgcctggttgccgtatttttccagaaaaagacgttc
ccggtggtgttgctggatgtggagcatagtaacataatggccttgtctacgctgttgctg
cgattcaagggtagtatcgggcttcgagatatcgaaaaccatatcctgttgattcttcac
cggctggattgtcggggaggacgttgggacgttacagagaatgaaggcgaccagcttgct
caatatgagcggctgcggaaggtgatgagacctgatccgggaggtaatgagcaacaacag
aatggcgtttgggcagcaaaactgaggaaaaagctctttgaggctcccggcccatccgct
tccacatag

DBGET integrated database retrieval system