KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2798Help
Entry
Lferr_2798        CDS       T00758                                 

Definition
(GenBank) transposase, IS4
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2780866..2781180
Genome map
AA seq 104 aa AA seqDB search
MKDGTLREDCAFGLTSLTKDRTTPENLLGIARGHWEIENRNHHVRDTTYHEDLSQIRTEN
GPHMMATLRGLAMSILRLIGVKNIAQAGRDFAASARKTLRQFGY
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacggcacccttcgtgaagattgcgctttcggactcaccagcctcaccaaagat
cggacgactcctgaaaatctgctgggcatcgcccggggccattgggagatcgaaaaccgc
aaccatcatgtccgcgataccacctatcacgaagacctctctcaaatccggaccgaaaac
ggaccacatatgatggcgactctacgtggcctcgccatgagcatcctgcgtctcatcggg
gtgaaaaacatcgcccaggctggccgtgacttcgccgccagcgctcgcaaaacactccgc
cagttcggttactga

DBGET integrated database retrieval system