KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2800Help
Entry
Lferr_2800        CDS       T00758                                 

Definition
(GenBank) Tn7-like transposition protein D
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2782127..2783956)
Genome map
AA seq 609 aa AA seqDB search
MLAYFPEIYPDELLYSALARYHRHVCSRSPKHTLYDLFGETGVRATVGLQSHVAALSQRI
PADRGLSPERLTRDFTLYRYYTAFEPKSVGQSVLASLADGPADAVHVRLGIAASAISAPA
YLRYCPICFGEMLSRYGEGYWRRSHQLPGVLVCPDHGAALADSAVSQGGSNQHEFIAADQ
KNCSPVAALPSWASSPRQVTLLQEIAKRSAALLDHPPARPSFRDWSAYYRSAVIDRGFGK
GKENVAQNLLREAISSLFEPVIDLIPGGLGDDWPTAMVRKHRKAFHPLRHVLFQIFLDKR
SPQRRTETPFGKGPWPCFNRLADHYGQDVIYEIAVRHEQNRVIGRFSCACGFVYSREVGS
RSSPRILDFGPLLDGQIRQKVAEGLGLRAVAKYLAIDPGTVRLHASRRGLNVPWKPLAAR
HSRTLVPDRDAIRIRWLDMQQNYADLSRRRLALLLPKEHSWLYRHDREWLEQHSPTALHK
KWSDQRVDWETLDRSMAIQLRKAAREITREVPPQRVTQAALERKLGRPLRMSEQQAKLPK
SIGVLGEVTETIDAFRLRRIAWAVSELDRQALPLRSWRVRRLAGLPSIASPSVETALAAL
EIMAGSFEV
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
gtgttggcctatttcccggaaatttatcccgacgaactgttatacagcgcgcttgcgcgt
tatcatcgccacgtttgttccagaagcccgaaacacaccctgtatgatctctttggtgaa
accggggtgcgggcgacggtgggcttgcaaagccatgtggcggcgttgagccaaagaata
ccggccgatcgcggactcagtccggaaagactgaccagggattttaccctctaccgttat
tacacggcattcgagccgaagtcagtgggacaatccgtactggcgtcattagcggacggc
ccggcggatgccgtgcatgtgcgtctgggtattgcggcgagcgcgatttcggctccggca
tacttacggtattgtcccatctgctttggcgagatgttgagccgctatggagaaggatat
tggaggcgcagccatcaactccccggcgttctggtttgtccagatcatggcgcggccctg
gcggacagtgcggtctctcaaggtggcagtaaccagcacgaattcatcgccgcggatcaa
aagaactgttcgcctgtggcggcactcccttcttgggcgagtagcccgcgccaagtgacg
ctgttgcaagagattgccaagcggagcgcggcgttgctcgatcatccgccagcgcgcccc
agctttcgcgattggagtgcatattatcggagcgcagtgattgatcgcggcttcggcaaa
ggcaaggagaatgtcgctcagaaccttctcagggaagcaatttcaagcctgtttgaacca
gtaatcgaccttatccccggtggtctcggcgacgattggcctacggccatggtacggaaa
cacagaaaggcatttcatccgttgcggcatgttctattccagatttttctggacaaacgg
tcgccgcaacggcggacggaaacccccttcggcaagggaccgtggccctgctttaatcgt
ctggcagaccattatgggcaagacgtgatctacgagatcgctgttcgccatgaacagaat
cgggtgattggtcgattttcctgcgcctgcggatttgtgtacagtcgagaggtgggatca
aggagttcgccgcgcattttggactttggtcccctactggatggtcaaatccggcagaaa
gtggcggaaggcctgggactcagggcggtagccaaatatcttgccattgatccagggacg
gtgagattgcacgcctcccgacgcgggttgaatgtgccctggaagcccttagccgcacga
cattcccgaacattggtgccagaccgggatgccataagaatacggtggttggacatgcag
cagaattacgctgatttatcacgtcggcgactggcactcctgctacccaaagaacactca
tggttgtaccgccatgacagggagtggctggagcaacattcaccaacggcactgcacaag
aaatggtctgatcagcgtgtggactgggagacattggatcgtagcatggcgatccaactg
cgtaaggccgcgcgggaaatcactcgggaggttccgccacaacgcgttacccaggcggct
ttggagcgcaagttggggcggccactccggatgtcagaacaacaggcaaaactgcctaaa
agtatcggtgtacttggcgaggtcacggagactattgatgcgtttcgcctgcgccgtatt
gcttgggctgtctcggaattggatcgccaggcgttgcctttgcgatcgtggcgggtacgc
cgcttagcagggctgccttcgatagcttcaccgagcgtagaaaccgccttggccgcattg
gaaataatggctggatcctttgaggtataa

DBGET integrated database retrieval system