KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2802Help
Entry
Lferr_2802        CDS       T00758                                 

Definition
(GenBank) HMG-I and HMG-Y, DNA-binding
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2785607..2787772)
Genome map
AA seq 721 aa AA seqDB search
MRDLSVNQLLEYPDEGKIERILWVDPAMSGLYAIDIHAPTAMPVFREAEEMERMRETGEW
RVTEADPWLAFLADEGIPETYRSKRDRAWAMIRALIFDQPAIFQSVSRSRAVQAAMAETG
ATKQTIYRLLRRYWQRGMTPNTLLPDYDRCGGRGNEKPSSGKKRGRTADRDDSGVNVTPQ
MRELFRAVVTGKFAKNNQMDFRAAYDELIVSAFSERVINERTGRQELVPRKDAPTLRQFR
YWFDKDNDVFRVDRIRRTPRVYDKDRRALLGSSTAETVGPASRYQIDATIADVYLVSRYD
RTKIVGRPVLYIVIDVFSRMITGVYVGFEGPSWVGAMMALSNTATEKVEYCRQFGVEIGA
ADWPCQALPDALLGDRGEIAGSAIETLINNFQVRVENAAPYRADWKGIVEQRFRLIPARF
KAYVAGYVAPDFQERGARDYRLDATLDIDQFTRIVLYCILYYNNQHLLRDYEKSSDMIAD
GVQAIPSDLWDWGIAHRSGSLRAFPPERVRLSLLPSGEATVTATGIRYAGCFYSCQKAIE
EHWFERARQRARWKVRISYEPRCMDEIYLQDETGRGHFIPCALTEKSRHHQGRTLWEIDQ
IRQEESRAARNHERQILRGRINLAENIKGIVHEAQTMRVDAPDPSGSNRQRTGSIRENRR
VEKRENQEREAFRPGRRREDASVKGEILPFPKGNPEDDYSLPDITEILRAQNEEQGDDDA
G
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgagggatctgtcggtcaaccaattgctggaataccccgatgaagggaagatcgaaagg
atcctctgggtcgatcccgcgatgagcggcctctacgccatcgacattcatgcgccgacc
gccatgcccgttttccgcgaggcggaggaaatggagcggatgcgcgagacgggcgaatgg
cgcgtcaccgaggccgatccctggctggcgttcctggccgacgagggcatcccggaaacc
taccggtcaaagagggaccgcgcctgggccatgatacgcgctctgatttttgaccagccc
gccatcttccagtccgtttcccgaagccgggcggtccaggcagcgatggcggagacgggg
gccaccaagcagacaatctaccgcctgctgcgccgctactggcagcgcggcatgacgccg
aacacgctgcttcccgattacgaccgctgcggaggtcgaggtaacgaaaaaccctcttct
gggaaaaagcgtggccggactgcggacagggacgattcgggcgtcaacgtcacgccacaa
atgcgggaactgtttcgtgcggtggtcaccgggaaattcgcgaagaataatcagatggat
tttcgggccgcctacgacgaactaatcgtaagcgccttttctgagcgggtcatcaatgag
cggaccgggcgccaggaactggtaccccgcaaggacgcccccaccctgaggcagttccgc
tactggttcgacaaggacaacgacgttttccgagtcgaccgaatccgccgcacgccgcgg
gtgtacgacaaggaccggcgcgccctcctgggatcgtcgacggcggaaacggtcggcccc
gcctcccggtaccagatcgacgcgaccatcgcggacgtgtacctggtatcgcgatatgac
cgtacaaagatcgtcggacgcccggtgctctatatcgtcatcgacgtgttcagccgcatg
atcaccggcgtgtatgtggggttcgagggaccttcctgggtcggggcgatgatggccctg
tccaacaccgccacggaaaaggtggaatattgccgccagttcggcgtcgagatcggcgcg
gcggactggccgtgccaggccctgcccgacgctttgctcggcgaccggggagagattgcc
ggcagcgccattgagacccttatcaacaacttccaggtgcgggtggaaaacgccgcgccc
taccgtgcggactggaagggcatcgtcgagcagcgattccgcctgattcccgcccgtttc
aaggcctatgtggccggctatgtcgccccggatttccaggagcgcggggccagggactac
cgtctcgatgcgactctggatatagatcaattcacccgtatcgtcctctactgcatcctg
tactataacaaccagcatctcctccgggattacgagaaatcgtccgacatgatcgccgac
ggagtccaggcgatcccatccgacctatgggactgggggattgctcatcgaagcggtagc
ctgcgcgccttcccgccggaacgggtgcgattgagcctgctgccgagcggcgaggcgacc
gtcacggccacaggcatccgctatgccggctgcttctacagttgccagaaggcgatcgag
gaacactggttcgagcgcgcgcgacaacgcgcgcgatggaaggtgcggatctcctacgaa
ccgcgctgcatggacgagatatacctgcaggacgagacgggacggggccacttcattccg
tgcgctctgaccgaaaagagtcggcatcaccagggccggacgctatgggagatcgaccaa
atccgtcaggaagaaagccgggccgcgcgcaaccatgagcggcagattctgcgcggtcgc
atcaacctcgccgagaacatcaaaggaatcgttcacgaagcccagaccatgcgcgtggac
gcgcccgatccatccggcagcaatcgccagcgaacgggcagcatccgcgaaaaccgtcgc
gtggaaaaacgggagaaccaggaacgggaagccttccgccccggtcggcgccgggaggat
gcttcggtaaaaggggaaatcctccccttccccaaggggaatccggaggacgactacagt
ctgccggacatcacggagattctgcgcgcgcagaacgaagagcagggcgatgacgacgcg
ggatga

DBGET integrated database retrieval system