KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2804Help
Entry
Lferr_2804        CDS       T00758                                 

Definition
(GenBank) glucosamine/fructose-6-phosphate aminotransferase, isomerizing
  KO
K00820  
glucosamine---fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Lferr_2804
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Lferr_2804
Enzymes [BR:afe01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     Lferr_2804
Peptidases [BR:afe01002]
 Cysteine Peptidases
  Family C44
   Lferr_2804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2788779..2790614)
Genome map
AA seq 611 aa AA seqDB search
MCGIVGGVSKTDLVPMILEGLQRLEYRGYDSAGLAILGADADLLRVRSVGRVAELTAAVV
ERGLQGQVGIGHTRWATHGGVAECNAHPMISHEQIAVVHNGIIENFHALRAHLEAAGYTF
TSETDTEVIAHLVHHYRQTAPDLFAATRRAVGDLRGAYAIAVISSGDPETVCVARMGCPL
LLGVADDGHYFASDVAALLPVTRRVLYLEDGDVAMLQRQTLRITDQAGASRQREEHWSQL
SAAAVDLGPYRHFMQKEIHEQPRAVADTLEGALNSQLDLTDLWGDGAAAMFRDVDRVLFL
ASGTSHYATLVGRQWVESIVGIPAQAELGHEYRYRDSIPDPRQLVVTLSQSGETLDTFEA
LRRAKDLGHTRTLAICNVAESAIPRASALRFLTRAGPEIGVASTKAFTTQLAALYLLALS
LAKAQGHLNDVQQADHLDALRQLPGSVQHALNLEPQIQGWAARFASKDHALFLGRGLHYP
IALEGALKLKEISYIHAEAYPAGELKHGPLALVDRDMPVVVIAPNDRLLEKLAANMQEVH
ARGGELYVFADSDSHFNASEGVHVMRLPRHAGLLSPIVHAIPVQLLAYHAALVKGTDVDR
PRNLAKSVTVE
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtattgtcggtggggtgagtaaaacagatctggtcccgatgattctggagggg
ttgcagcgcctggagtatcgtggctacgactctgccgggctggcgatattgggggccgat
gcggatttgctgcgggtgcgcagcgtcgggcgggtcgccgagctgaccgccgccgttgtc
gagcgtggcttgcagggtcaggtgggcatcggccacacgcgctgggccacccatggcggc
gtcgccgaatgcaatgcgcatcccatgatctcccatgaacagatcgctgtggtccataac
ggcatcatcgagaactttcatgccttgcgcgcccacctggaagcagcggggtacaccttc
acctccgagaccgatacggaggtcatcgcgcatctggtgcaccattatcggcagaccgcg
ccggacctgttcgcggcgacccgccgggcagtgggcgatctgcgcggcgcctatgccatt
gcggtgatctccagcggcgatccggagaccgtgtgcgtggcacggatgggctgcccgctg
ctgctgggcgttgccgatgatgggcattacttcgcctcggacgtggcggccctgctgccg
gtgacccgccgcgtgttgtatctcgaagacggcgatgtggccatgctgcagcggcagacc
ctgcggattacggatcaggccggagcgtcgcggcagcgggaagaacactggagccagctc
agtgcggcggctgtcgatctggggccttaccgccacttcatgcagaaggaaatccacgaa
cagccccgcgcggttgccgataccctggaaggtgcgctgaacagtcaactggatctgaca
gatctctggggagacggtgccgcggctatgtttcgcgatgtggaccgggtgctgttcctg
gcctccggcactagccactacgcgacattggtgggacgccaatgggtggaaagcattgtg
gggattccggcgcaggccgagctggggcacgaatatcgctaccgggactccatccccgac
ccgcgccagttggtggtgaccctttcgcaatccggcgaaacgctggatactttcgaggcc
ttgcgccgcgccaaggatctcggtcatacccgcacgctggccatctgcaatgttgcggag
agcgccattccgcgggcgtcggcgttgcgcttcctgacccgggccggcccagagatcgga
gtggcctcgaccaaggcgttcaccacccagttggcggcgctctatctgctggctctgtcc
ctggccaaggcgcaggggcatctgaacgatgtgcagcaggcggatcacctggacgccttg
cggcaactgccgggcagtgtccagcatgccctgaacctggagccgcagattcagggttgg
gcggcacgttttgccagcaaggaccatgcgctttttctggggcgcggcctgcactacccc
attgcgctggagggcgcgctgaagctcaaggaaatctcctatatccacgccgaggcttat
cccgcgggcgaattgaagcatggccccttggccctggtggaccgcgacatgcccgtggtg
gtgatcgcgcccaatgaccgcctcctcgaaaagctggccgccaacatgcaggaagtccac
gcccgtggcggtgagctctatgtttttgccgattcggacagccactttaacgccagtgag
ggcgtgcatgtgatgcgtttgccccgtcacgccggtctgctctcccccatcgtccatgct
atcccggtgcagttgctggcctatcatgcggcgctggtgaagggcaccgatgtggatcga
ccgcgtaacctcgcgaagagcgtgacggtggagtaa

DBGET integrated database retrieval system