KEGG   Acidithiobacillus ferrivorans: Acife_0082Help
Entry
Acife_0082        CDS       T01595                                 

Definition
di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
afi  Acidithiobacillus ferrivorans
Brite
Enzymes [BR:afi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Acife_0082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
95557..96690
Genome map
AA seq 377 aa AA seqDB search
MGKIAKLHGQHQYRLVIARAVLAVSICLGGIEVAFAFGGEFPSKVPVPANNPMTPAKIAL
GKQLFFDPRLSLTGDVSCETCHNVMGNGSDGLPLAFGVLGRVDTPRHAPSVFNAAFNTVQ
FWDGRANSLEAQAKGPILNHVEMGMPNAADLVRRLQEIPGYRDEFRNVFGDKDPITFEHV
AQAIATYERTLVTPGSPYDRYVKGDKAALSSSAIAGMKTIRSFGCEACHAGPMFDNPGTP
MGTGWFQKFPVQPHNPVCAKYVQKYHLMDDPGRFDVTHKAADMHVFKVPSWRNVALEAPY
FHNGSVGTLQTAVRVMAACQLGLTVTNKQVSDIVSFLDSLTGKFPKETMPTLPETPNTTI
MMNVSRLEKVAVKNAKK
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaaaatcgcaaagctacatggacaacatcaatataggctggtcatcgctcgtgcg
gttctggcggtaagtatttgtctgggcgggatcgaggtggcattcgcttttggcggcgaa
ttcccgtcgaaggttccggtgccggcaaacaacccgatgacacccgcaaaaatcgctctt
ggtaagcaactgttttttgatccacgactatcccttaccggcgatgtatcctgtgaaacc
tgtcacaacgtcatgggcaatggcagtgacggtttgccccttgcgttcggggtgcttggc
cgggtggacacgcctcgccatgcgccatcggtctttaatgccgctttcaataccgtgcag
ttctgggatggtcgtgccaatagcctggaggcccaggccaaaggtcccatcctcaaccat
gtggaaatgggaatgcccaatgcagcggacctggtcagacgcttgcaagagatacctggc
tatcgcgatgaatttcgtaatgtgttcggcgacaaagatcctatcaccttcgagcacgtt
gcacaggctatcgccacttatgaacgtacattggtaacaccaggcagtccgtatgatcgt
tacgtcaaaggcgataaagcggcgcttagcagcagcgccatagccgggatgaaaacaatc
cggtcgttcggatgtgaggcgtgccatgccggaccgatgttcgacaatcccggtacgccc
atgggaactggatggttccagaaattcccggtgcaaccgcacaatccggtctgtgccaaa
tacgtacagaaatatcatctcatggatgatccaggccgtttcgacgtgacccacaaagcg
gcagacatgcatgtattcaaggttcccagttggcgcaatgttgccctggaagcgccctat
ttccacaatggttccgtggggactctgcagactgcagtgcgggtcatggcagcttgccaa
ttgggtctgacggtcacgaataagcaggtgagcgatattgtttcctttttggacagcctc
accggcaagtttcccaaagaaaccatgccaacccttccagagacgcctaacaccaccatt
atgatgaatgtttctcgcttggaaaaagttgcagtgaaaaatgcgaagaagtaa

DBGET integrated database retrieval system