KEGG   Acidithiobacillus ferrivorans: Acife_0111Help
Entry
Acife_0111        CDS       T01595                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:afi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Acife_0111
Enzymes [BR:afi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Acife_0111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(127472..129412)
Genome map
AA seq 646 aa AA seqDB search
MTSAMMDQLRSWTEEGWLRPLDLAFAQFLIRLDPQAPALLPLAGALLARLEGEGHPCVAL
DDFLSAPERFLDWPAPELATLATALGYWPHAAAWTETLAQSLCVQVTERNISDPANSAET
PLVLSATRLYLRRYWRDQQFIAETLRQRAQQRVADTAKPEALKPWLEQLFPAPDETRNEL
PWQKIACALALRSHFGIITGGPGTGKTYTAARLMTLLMATSSTALRIVLAAPTGKAAVRI
DESLQSAVSTLPQLGPGPDMAAAFARLRPARTLHSLLGARPDRRRFRHNAANPLELDVLV
VDEASMIHQEMMAALLRALPPTARLILLGDQDQLASVEAGAVLAEICQGSGSYDTETCHY
LQASCGATPQPNDSGTSPLTASIVRLQRSHRFNAEIGALADAVHGGHPETAIRILQAAQT
STLAWQSAPAIHQILDLAGTEIAYGRVWQAAGQPPPKDPQQHSAWVKAILKDYADFRILC
ALRQGPWGVTGINRAIEDYLQRQGILQSRGLWYVGRPALVTRNDSGLGLSNGDIGIALPD
PDRRMRVYFPNSDGPPRAILPSRLNHSESAWAMTVHKAQGSEFAHTVLILPPEDSPVLSR
ELLYTAITRARICFTLIAPRARLENAIQRQTRRMSGLHAALRNARR
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgacctcagccatgatggaccaactccgcagctggactgaggaaggctggctacgcccc
ctcgacctcgcctttgcgcagttcctcatccgcctggacccgcaggccccggccctcctg
cccttggcgggtgccctcctcgcgcgcctcgagggggaagggcacccctgcgtcgcgcta
gatgacttcctcagcgcgcccgaacgcttcctggactggcccgcgccggagctcgccacg
ctggcaaccgcgctcggttactggccccacgccgccgcatggacagaaaccctcgcccag
agcctctgcgtgcaggtcaccgagcgcaacatatccgacccggcaaacagcgcagaaaca
cctctggtcctcagtgccacccgcctttatttgcgccgctactggcgcgaccagcaattc
atcgccgaaactctgcgccagcgtgcccaacagcgtgtcgccgataccgccaagcccgag
gccttaaaaccctggctggagcagcttttccccgcacctgacgaaacccgcaacgagctc
ccctggcaaaaaatcgcctgcgccctcgccctgcgcagtcacttcggcatcatcaccggc
ggccccggcaccggcaaaacctacaccgcagcgcgcctcatgaccttgctcatggcgacc
agcagcaccgctctgcgcatcgtcctcgccgcccccaccggcaaggccgccgtgcgcatt
gacgaatccctgcagagcgccgtcagcacccttccgcaactgggcccgggacccgatatg
gccgccgccttcgcccgcctgcgtccggcgcgcaccctgcacagcctgctcggcgcccgt
cccgaccgccgccgctttcgccacaatgccgccaatcccctcgaactcgacgtactggtg
gtggatgaagcctccatgatccatcaagagatgatggccgccctgctccgcgcgctaccg
cccacggcccgcctcattctcctcggcgaccaggaccagctcgcctccgtcgaagcgggc
gccgtgctggccgagatctgccaaggcagcggtagctacgataccgagacctgccactat
ctgcaggccagttgtggtgccacaccgcagcccaacgacagcggcaccagcccccttaca
gcaagcatcgtccgcctgcaacgcagtcaccgcttcaacgccgaaatcggcgctttggcg
gatgccgtccacggcggtcaccccgaaaccgctatccgcatcctgcaagctgcgcagacc
agcaccctcgcctggcaatccgcccccgccatccaccagatactggatctcgccggcact
gagatcgcctatggccgcgtctggcaagcggcgggacagccgccgccaaaagacccgcaa
caacatagcgcgtgggttaaggccatcctcaaagactatgccgatttccgcatcctctgc
gccttgcgccaaggcccttggggcgtcaccggcatcaaccgcgccattgaagactatctg
caacgccagggcatcttgcagagccgcggcctttggtatgtcggccgccccgccctcgtc
acccgcaacgactccggcctcggtctcagcaatggcgatatcggcatcgccctgcccgac
ccggataggcgtatgcgcgtctattttcccaacagcgacggcccgccccgtgccatcctt
cccagccgtctcaaccacagcgaaagcgcttgggccatgaccgtccacaaggcgcagggc
tccgagttcgcccacaccgtactcatccttccgccagaagacagcccagtgctgagccgc
gaactgctctacacggccatcacccgggcccgcatctgcttcaccctcatcgccccccgc
gcgcgcctggaaaacgccattcagcgccagacgcggcgcatgagcgggctacatgcggcc
ttgcgcaatgccagacgttga

DBGET integrated database retrieval system