KEGG   Acidithiobacillus ferrivorans: Acife_0174Help
Entry
Acife_0174        CDS       T01595                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:afi01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:afi00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(188131..188922)
Genome map
AA seq 263 aa AA seqDB search
MADILKEIIARKREELAERKARLGLTELQSVVALTAPPRDFIGAIQAKIAQGQAAVIAEV
KKASPSAGVIREDFNPVIIAQDYATHGAACLSVLTDAHYFQGADLYLTAAREACTLPVLR
KDFCIDPYQVWEARAIGADAILLIVGALSDAELQSLEAIAQSLDLAVLAEVHDAAELQRA
LKLRTPLIGINNRDLRRFVTAIETTLQLLPEMPEGRIVVTESGIHRREDVATLRAAGVGA
FLVGEAFMRAAQPGAALEHLFFD
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggccgacatacttaaagaaattattgcccgcaagcgcgaagagttggctgaacgcaaa
gctcgcctgggcctcacggagctgcaatcggtagtggccctgacggccccgccccgtgac
ttcattggcgccattcaggccaaaatagcccaaggacaagccgccgtgattgccgaagtc
aagaaggcatcgccgtcggcgggagttatccgcgaggacttcaacccggtgatcattgcc
caggattacgcgacccatggggcggcctgcctgtcggtcttgaccgatgcgcactatttc
cagggtgctgacctctatctgaccgccgcccgcgaagcctgtacactgccggtattgcgc
aaggatttctgtattgatccctatcaggtctgggaggcacgcgccatcggggccgatgcc
atcctgctcatcgtcggggcactgagcgatgccgaactacagagcctggaagccatcgcg
cagagcctcgatctggcggtactggcagaggtgcatgatgcggccgagttacagcgggca
ttaaagttgcgcacgcccctgatcggcatcaacaatcgggatctgcggcgctttgtcacc
gcgatcgaaaccacgctgcaactactgccggagatgcccgaagggcggatagtggtcacc
gaaagtggcattcatcgacgcgaagatgtggcgactttgcgcgcagcgggagtgggtgct
tttctcgtcggcgaggcattcatgcgcgccgcacagccgggagcggccctggaacatctg
ttttttgattaa

DBGET integrated database retrieval system