KEGG   Acidithiobacillus ferrivorans: Acife_0325Help
Entry
Acife_0325        CDS       T01595                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Acife_0325
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Acife_0325
Enzymes [BR:afi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Acife_0325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
346583..347647
Genome map
AA seq 354 aa AA seqDB search
MPLQTDLQRPARGPLMVDIAGLQPTAAECAMLRQSAVGGVILFARNCVDAEQVRALCGEL
HALRSPPLLIGIDQEGGRVQRLRAGVTRFPPMATLGRLADRDGLEKAQTAARDWGLLLGT
ELRALGLDMDFTPCVDLDRGVSAVIGDRAIHRDPEWVGGIAVAFWAGMVRTGLQGVAKHF
PGHGAVAADSHLDLPLDKRPLSAIQEDLQPFAALIAAGIPAIMPAHCLYPQVDPERPAGF
SPRWLQDILRKDMGFTGVVVSDDLSMAGAHGVGDMAARVDAALAAGADLLLICNDPEGAQ
MAAVHLQSKDKFPTGNRLERLAGNAATAPLSAADRARCLQQIEQLRALTPGFAG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgccgctacagactgatctgcagcgccccgcacggggcccgctgatggtggatattgcc
gggctgcagcccactgccgctgaatgcgcgatgctgcgtcagtcggcagtgggtggtgtc
atcctttttgcccgcaactgcgtcgatgccgaacaggtgcgcgccttgtgcggcgaattg
catgcgctgcgttctccgccgctgctcatcggtattgatcaggaagggggacgggtgcag
cgtttgcgcgccggagtgacgcgcttcccgcccatggcgactttgggtcgtctggcggac
cgtgacggcttggaaaaggcgcagacggcagcgcgggactggggacttctgctcggtacg
gagctccgggcgcttggcctggatatggactttaccccttgtgtggatctggatcgcggc
gtttctgcggtgattggcgaccgcgccatccatcgcgatcccgaatgggtggggggtatc
gcggtagcgttctgggcgggcatggtgcggaccggcttgcagggggtcgccaagcatttt
cccggtcacggtgcggtagccgccgactctcatctcgacttgcctctcgataagcgcccg
ctcagcgccattcaggaagaccttcagcccttcgctgccctgattgctgcggggattccg
gcgattatgcccgcgcactgcctctatccccaggtggatcctgaacggcctgccggtttc
tcgccgcgctggctacaggatatcctccgcaaagatatgggcttcactggtgtggtggtc
agtgacgacctcagcatggcgggtgcgcatggtgtcggcgatatggccgcgcgggtggat
gcggcactggcggcaggcgcggacttgctgctaatctgtaacgatccggagggcgcgcaa
atggcagccgtccatttacagtccaaggataagttcccgacgggcaatcgcctggagaga
ctcgccggcaacgctgcaacagcacctttgtctgctgcagaccgggcgcgctgtttgcag
cagatcgagcaattgcgggccctgaccccaggattcgctggctga

DBGET integrated database retrieval system