KEGG   Acidithiobacillus ferrivorans: Acife_0728Help
Entry
Acife_0728        CDS       T01595                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
afi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:afi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Acife_0728
Enzymes [BR:afi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Acife_0728
DNA repair and recombination proteins [BR:afi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Acife_0728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 HHH_5 Viral_helicase1 AAA_11 Helicase_RecD HHH_2 AAA_29 T2SSE RsgA_GTPase AAA_16 NTPase_1 AAA PIF1 AAA_22 UvrD_C DEAD NACHT cobW UvrD-helicase MMR_HSR1 ABC_tran AAA_23 ATPase_2 PhoH AAA_28 DUF2075 ArgK ABC_ATPase MobB DUF4314 TrwB_AAD_bind ATP_bind_1 TsaE Zeta_toxin AAA_3 AAA_14 AAA_18 SMC_N
Motif
Other DBs
NCBI-ProteinID: AEM46926
JGI: Acife_0728
UniProt: G0JLH4
Position
750491..752674
Genome map
AA seq 727 aa AA seqDB search
MAKPERQKQDTPNELLGGLIERVTFHNDGSGFCVLRIKARGHKELVTVVGHAAAVTAGEW
ITASGLWITDRDHGLQFKAAFLKISAPTSLDGIEKYLGSGMIRGIGPVYAKKLVKAFGDQ
VFTVIEETPERLAEVEGIGPIRRERMVSAWADQKVIREIMLFLHTHGVGTARAVRIFKTY
GTDAVRVMTENPYRLARDIHGIGFKTADAIAMKMGIEPHAPIRVRAGISYALMEARDEGH
CGLPHEELIPLAEKLLEVPTGAIESAIQEELREGAIIADQVQDADCVFLAPLYRNEQGIA
SLLKHLRTGKAPWAGIAADAAIDWVQKRLNIDLADSQQSAIRMVLQEKVALITGGPGVGK
TTLVNAILNILDAKKLRIALAAPTGRAAKRMSETTGKEAKTIHRLLEIDPQGGGFKRKED
YTLDIDLLVLDECSMIDVPLMHAVLKALPSQAGLLMVGDPDQLPSVGPGQVLADLIAAKT
IPEVHLTEIFRQAAQSRIIQAAYQINAGHTPDLRNPEGLSDFYYIAADDPAEAAEKLVKL
VTTHIPRRFGLDPLHDIQVLCPMNRSALGARALNEALQTALNGESTPTIEKFGRRFAPGD
KVMQIQNDYEKEVFNGDIGFVQGVDVEEGTLTVDFEGREVSYVFGELDLLQPAYAITVHK
SQGSEYPAVVIPMSTQHYPMLQRNLLYTAVTRGKRLVVLVGQKKAVAMAARNGSGKRRWS
KLREWMQ
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaccggagcgccagaagcaggatacccccaatgaactgctcggtggactgatc
gaacgggtcaccttccataacgatggaagcggcttctgtgtgctccgcatcaaagcccgt
ggccacaaggaattggtcaccgtcgtggggcatgcggcagccgtcactgcgggtgagtgg
atcacggcttcgggcctctggatcaccgatcgcgatcatggcctgcagttcaaagccgct
tttctgaaaatctccgcgccgaccagcctggatggcatcgaaaagtatctgggctccggc
atgatccggggcattggtcccgtctatgccaaaaagctcgttaaagcttttggggatcag
gtattcaccgtcatcgaagaaacaccggaacgcctggcggaagtggaaggtattggccct
attcgccgggaacgcatggtcagcgcctgggcggaccagaaagtgattcgtgagatcatg
ctgtttctgcacacccatggtgtgggtaccgcccgggcggtgcgcatcttcaaaacctac
ggcaccgatgccgttcgggtcatgacggaaaacccctatcggctggccagggatattcat
ggcatcggcttcaaaaccgctgacgccatcgccatgaaaatgggtattgaaccccatgct
cccattcgggttcgggcaggcatttcctatgccctcatggaggcacgcgacgaggggcac
tgcggattaccgcatgaggaactgatccctctggccgaaaagttgctggaagtcccgaca
ggcgccatcgaaagcgccattcaggaagaattacgggaaggggcgatcatcgcagatcag
gtgcaggacgccgattgtgtcttcctggcccccctttaccgcaatgaacagggcatcgcc
agcctcctgaagcatctacgtactggcaaagccccatgggcgggcattgcggccgatgcg
gctattgattgggtgcagaagcggctgaatattgatcttgccgacagtcagcaatcagcc
atccgtatggtgttgcaggaaaaagtggcactgattaccggcggccccggtgtgggaaag
accacgctcgtgaacgcaatcctgaatatcctcgacgccaagaaactgcgcatcgcactg
gccgcccccaccggacgtgcggccaaacgcatgagtgaaaccaccggcaaagaggccaag
accatccaccggctcctcgaaatagatccccagggcggtgggttcaaacgcaaagaggat
tataccctcgatatcgatctgctggtcctggatgaatgctccatgatcgacgtgcccctg
atgcacgccgtcctcaaagccctgccatcccaggcgggactgctgatggtgggtgatccc
gatcagttgccctccgtaggcccagggcaggtgctggctgatctcattgccgccaaaacc
atccccgaagttcatctgacggaaatctttcgccaggcggcgcaaagccggatcattcag
gcggcctatcagatcaatgcagggcacacgccggacctgcgaaacccggaggggctcagc
gatttttattacatcgcagcggatgatccagcggaagcggcagaaaagctcgtcaaactg
gtcaccacccatatcccacgtcgcttcggcctggacccgctgcatgatatccaggtgctt
tgccccatgaaccgcagtgcgctgggtgcccgcgcgctcaatgaagcgctccaaacggcc
ctcaatggtgaaagcacaccaaccatcgaaaagttcggccgccgtttcgcacccggtgac
aaggtcatgcagatccagaacgattatgaaaaagaggttttcaatggcgacatcggattt
gtgcaaggtgtggacgtggaagaaggcaccctgaccgtagactttgagggcagagaggtc
agctatgtttttggggaactggatctcctgcaaccggcctatgccatcaccgtgcacaag
agtcagggttcggagtatcctgccgtggtcattcccatgagcacgcaacactaccccatg
ctgcaacgcaatctgctctatactgctgttacccggggcaagcgtctggtcgtgcttgtg
ggtcagaaaaaggctgtggccatggcggcgcggaatggatccgggaaacggcgatggtca
aaactgcgggagtggatgcagtag

DBGET integrated database retrieval system