KEGG   Acidithiobacillus ferrivorans: Acife_0853Help
Entry
Acife_0853        CDS       T01595                                 

Definition
DNA-binding DNA glycosylase/AP lyase, H2TH
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:afi00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Acife_0853
Enzymes [BR:afi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Acife_0853
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Acife_0853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
871237..872040
Genome map
AA seq 267 aa AA seqDB search
MAELPEIELLRQKLRRSILHKRVGVMQMQNAKGEPLTDGAGMDDAALQGKAITDLHRYGQ
YLFLELDRKDILAMQLGGELSGELERGPAQAEGGEEPRAALEIQINGQQRLRFQGTQLGN
RLRLLDENSDVDFLTKLGPDPLMVHGEGLGVLREALSRRRSALRNILLDDTFAPGIGGIW
ADEILFQARLRPDRTATSLSEEDRERFLEQIPKVLDRAVRCQAKTNLLPKTFLTRHRADG
HCPSCGGALETLAVGGKSALFCPACQS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggccgagttgccagaaatagaactgctcagacaaaagctgcggcgcagtatcctgcac
aagcgggtcggcgtcatgcagatgcagaatgccaaaggcgagccactgaccgatggcgcc
gggatggatgatgccgccctccagggcaaagccatcactgacctgcatcgctatggtcaa
taccttttcctggaactggatcgcaaagacatcctcgccatgcagttgggcggtgagctg
agcggcgaacttgaacgcggccctgctcaggcggaaggcggggaagagccgcgtgcggca
ttggagattcagatcaatggccagcagcgcttgcgttttcaggggacccagttgggtaac
cgcctgcgcctgctggatgaaaacagcgatgtggatttcctgaccaagctcggcccggat
ccgctgatggtgcatggagaagggctcggagtattgcgcgaagccctgagtcgtcgccgc
agtgccctgcgtaacatcctgctggatgatactttcgcgccgggcatcggcggtatctgg
gcggatgaaatcctttttcaggcccgtttgcggccggatcgcaccgcgaccagcctcagc
gaagaagatcgcgagcgtttcctggagcagatccccaaggtgctggatcgtgccgtgcgc
tgtcaggcgaagaccaacctgctgcccaagaccttcctcacccgccatcgggcagatggg
cactgtccgagttgtggcggcgcactggagacccttgcggtggggggtaagagcgcgctg
ttctgcccggcctgccagtcttaa

DBGET integrated database retrieval system