KEGG   Acidithiobacillus ferrivorans: Acife_0866Help
Entry
Acife_0866        CDS       T01595                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:afi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Acife_0866
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acife_0866
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Acife_0866
Enzymes [BR:afi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Acife_0866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
883087..884217
Genome map
AA seq 376 aa AA seqDB search
MTRYTGIIDHYRAFLPLAPETQAVSLGEGNTPLIECINLPRQLGLDIRLFLKFEGLNPTG
SFKDRGMTMAVTKAKEEGSEMVICASTGNTSAAAAAYAARAGMRAFVVIPEGKIALGKLS
QAMMHGAMVLQIRGNFDAGMQIVQEVAANAPITLVNSVNPYRLQGQKTAAFEIVEALGEA
PDYHALPVGNAGNITAHWMGYCEATDGRTDQSQSLTASCKFCDGACTYGHGKAGKRPKML
GFQAAGSAPFIVGHYVKDPETIATAIRIGHPMSWDQAHRVQAESGGWFGGHSDAEILEAQ
RWLAQYEGVFCEPASATSVAGVVAAARAGKIEAGATVVCTLTGHGLKDPDTAIAQGGEVL
TVDASLEAVQRAILDR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgacccgttataccggcatcatcgaccactaccgtgctttcctgcccctggctcccgag
actcaggcggtgagcctgggcgagggcaatacgccgctgatcgaatgcatcaatctgccc
cgccagctcggcctcgatatccgccttttcctcaaatttgagggcttgaatcccaccggc
tccttcaaggaccgcggcatgaccatggcggtgaccaaggccaaggaagagggcagcgag
atggtgatctgcgcctctaccggcaacacttcggcggccgcggcggcctacgcggcgcgg
gcgggaatgcgcgctttcgtggtgatcccggaaggcaagattgccctcggcaaactctcc
caggcgatgatgcatggtgccatggtgttgcagattcgcggcaacttcgatgcgggtatg
caaattgtccaggaagtggccgctaatgcgccgatcaccctggtgaactcggtgaatcct
taccgcttgcagggccagaagacggcggccttcgagattgtcgaggcgctgggcgaggcg
cccgattatcacgccctgcccgtgggcaatgccggtaatatcaccgcccactggatgggc
tattgtgaagccactgacgggcggactgaccagtcccagtctctgactgcttcctgcaaa
ttctgcgatggtgcttgcacctatggtcacggtaaggcgggcaaacgaccgaagatgctg
ggctttcaggcggcaggcagtgcccccttcatcgtcggccactatgtgaaagaccccgag
accattgccacggccatccgtattggacatcccatgtcctgggatcaggcgcatcgggtg
caggcggaaagcggcggctggtttggcggtcatagcgatgccgagattctggaggcgcag
cgctggctggcgcaatatgagggtgttttctgcgaaccggcttcggcgacttcggtggcg
ggggtggtggctgcggcccgcgccggaaaaattgaagcgggcgcgacggtggtctgtacc
ctcaccgggcatggcctcaaagatcctgataccgccatcgctcagggtggcgaagtgctc
accgtggatgccagtctggaggccgtgcagcgcgccatcctggaccgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system