KEGG   Acidithiobacillus ferrivorans: Acife_0866Help
Entry
Acife_0866        CDS       T01595                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
afi00260  Glycine, serine and threonine metabolism
afi00750  Vitamin B6 metabolism
afi01100  Metabolic pathways
afi01110  Biosynthesis of secondary metabolites
afi01120  Microbial metabolism in diverse environments
afi01230  Biosynthesis of amino acids
Module
afi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:afi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acife_0866
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Acife_0866
Enzymes [BR:afi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Acife_0866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Enterotoxin_HS1
Motif
Other DBs
NCBI-ProteinID: AEM47048
JGI: Acife_0866
UniProt: G0JML9
Position
883087..884217
Genome map
AA seq 376 aa AA seqDB search
MTRYTGIIDHYRAFLPLAPETQAVSLGEGNTPLIECINLPRQLGLDIRLFLKFEGLNPTG
SFKDRGMTMAVTKAKEEGSEMVICASTGNTSAAAAAYAARAGMRAFVVIPEGKIALGKLS
QAMMHGAMVLQIRGNFDAGMQIVQEVAANAPITLVNSVNPYRLQGQKTAAFEIVEALGEA
PDYHALPVGNAGNITAHWMGYCEATDGRTDQSQSLTASCKFCDGACTYGHGKAGKRPKML
GFQAAGSAPFIVGHYVKDPETIATAIRIGHPMSWDQAHRVQAESGGWFGGHSDAEILEAQ
RWLAQYEGVFCEPASATSVAGVVAAARAGKIEAGATVVCTLTGHGLKDPDTAIAQGGEVL
TVDASLEAVQRAILDR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgacccgttataccggcatcatcgaccactaccgtgctttcctgcccctggctcccgag
actcaggcggtgagcctgggcgagggcaatacgccgctgatcgaatgcatcaatctgccc
cgccagctcggcctcgatatccgccttttcctcaaatttgagggcttgaatcccaccggc
tccttcaaggaccgcggcatgaccatggcggtgaccaaggccaaggaagagggcagcgag
atggtgatctgcgcctctaccggcaacacttcggcggccgcggcggcctacgcggcgcgg
gcgggaatgcgcgctttcgtggtgatcccggaaggcaagattgccctcggcaaactctcc
caggcgatgatgcatggtgccatggtgttgcagattcgcggcaacttcgatgcgggtatg
caaattgtccaggaagtggccgctaatgcgccgatcaccctggtgaactcggtgaatcct
taccgcttgcagggccagaagacggcggccttcgagattgtcgaggcgctgggcgaggcg
cccgattatcacgccctgcccgtgggcaatgccggtaatatcaccgcccactggatgggc
tattgtgaagccactgacgggcggactgaccagtcccagtctctgactgcttcctgcaaa
ttctgcgatggtgcttgcacctatggtcacggtaaggcgggcaaacgaccgaagatgctg
ggctttcaggcggcaggcagtgcccccttcatcgtcggccactatgtgaaagaccccgag
accattgccacggccatccgtattggacatcccatgtcctgggatcaggcgcatcgggtg
caggcggaaagcggcggctggtttggcggtcatagcgatgccgagattctggaggcgcag
cgctggctggcgcaatatgagggtgttttctgcgaaccggcttcggcgacttcggtggcg
ggggtggtggctgcggcccgcgccggaaaaattgaagcgggcgcgacggtggtctgtacc
ctcaccgggcatggcctcaaagatcctgataccgccatcgctcagggtggcgaagtgctc
accgtggatgccagtctggaggccgtgcagcgcgccatcctggaccgctga

DBGET integrated database retrieval system