KEGG   Acidithiobacillus ferrivorans: Acife_1319Help
Entry
Acife_1319        CDS       T01595                                 

Definition
(GenBank) glycoside hydrolase family 8
  KO
K20542  endoglucanase [EC:3.2.1.4]
Organism
afi  Acidithiobacillus ferrivorans
Brite
Enzymes [BR:afi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Acife_1319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_8
Motif
Other DBs
NCBI-ProteinID: AEM47474
JGI: Acife_1319
UniProt: G0JQE3
Position
complement(1322227..1323468)
Genome map
AA seq 413 aa AA seqDB search
MREWNRQANPSGRASSSATRRRNLRCWLQSRTRWLGLGSLAMLFAVEGCAMLPSAGDSAP
NPAPWYQFWSSYQARFIDPQGRVIDWNDGGITTSEGQSYALFFALVANNPKLFQNILTWT
QDNLAQGSLAAHLPAWRWGERPNKTWGVLDTNSAADADLWIAYTLIQAGRLWDRNSYTAM
GTLLAKRIDQKEVVDLKGMGPMLIPGNAGFRIAPDTYVFNPSYLPLPVVEGLAHALPHGP
WRAMAAHLPGFIKAVSPHGFAPDWVAYSPQEGYHMAPQGADGSYNAIRVYLWAGMSNPDT
PGAQRILDSVSGMANYLQSHLLPPVSENWQTGATSGTGPTGFSAALIPYLMQKNMNPAMH
NQWLRLNADYDRANGLYGKTAHYYDQNLALFALGWVYHTIRFDRNGELKTAWH
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaatggaaccgacaagcgaatccttccgggcgtgcgtcctcttccgcaacacgc
cgccggaatctgcgctgttggttgcagtcgcggacccggtggctgggattagggtcgctg
gccatgctgttcgcggtggaaggctgcgcgatgctgccaagcgccggcgattcagcgccc
aatcccgcaccctggtaccaattttggtccagctatcaggcccgattcatcgacccgcaa
gggcgggtcatcgactggaacgatggcggcatcaccacgtcagaggggcagtcctacgcc
ttgttttttgcactggtggcgaacaatcccaaactgttccagaacattctgacctggacc
caggataacctggcgcaaggcagccttgccgcgcacttgcccgcttggcgctggggcgag
cgtcccaataaaacctggggcgtactcgataccaactcggcagcggacgcggacttgtgg
atcgcctacaccttgattcaggcagggcgcctgtgggaccgcaatagctacacggcaatg
ggtacgctgctggccaaacggatcgatcaaaaagaagtggtcgatctcaaggggatgggg
ccgatgcttatacccggaaatgcgggatttcgcatcgccccggacacctacgtcttcaac
cccagttatctgcctctgccggtcgttgaaggattggcgcacgccttgccacacggcccc
tggcgcgctatggcggcgcatctgcccggcttcatcaaggcggtcagcccccatggcttc
gcgccagactgggtagcctattctccgcaagaggggtaccacatggccccccagggagcc
gatggcagctataacgccattcgcgtgtatctctgggccggcatgagcaatcccgatacc
ccgggtgcccaacggatcctggacagcgtttcgggtatggcgaattacctgcaatcgcat
ctgctgccaccggtcagtgaaaattggcagactggcgcgacctcgggaacgggcccaacg
ggcttttctgccgccttgattccctacctgatgcagaaaaacatgaatccggcgatgcac
aaccagtggctcagactcaatgcagactatgatcgtgcgaatggcctctacggcaaaaca
gcccattactatgaccaaaacctcgccctcttcgccttgggatgggtataccacaccata
cgatttgaccgtaatggcgaactgaaaacagcgtggcattaa

DBGET integrated database retrieval system