KEGG   Acidithiobacillus ferrivorans: Acife_1319Help
Entry
Acife_1319        CDS       T01595                                 

Definition
(GenBank) glycoside hydrolase family 8
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
afi  Acidithiobacillus ferrivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1322227..1323468)
Genome map
AA seq 413 aa AA seqDB search
MREWNRQANPSGRASSSATRRRNLRCWLQSRTRWLGLGSLAMLFAVEGCAMLPSAGDSAP
NPAPWYQFWSSYQARFIDPQGRVIDWNDGGITTSEGQSYALFFALVANNPKLFQNILTWT
QDNLAQGSLAAHLPAWRWGERPNKTWGVLDTNSAADADLWIAYTLIQAGRLWDRNSYTAM
GTLLAKRIDQKEVVDLKGMGPMLIPGNAGFRIAPDTYVFNPSYLPLPVVEGLAHALPHGP
WRAMAAHLPGFIKAVSPHGFAPDWVAYSPQEGYHMAPQGADGSYNAIRVYLWAGMSNPDT
PGAQRILDSVSGMANYLQSHLLPPVSENWQTGATSGTGPTGFSAALIPYLMQKNMNPAMH
NQWLRLNADYDRANGLYGKTAHYYDQNLALFALGWVYHTIRFDRNGELKTAWH
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaatggaaccgacaagcgaatccttccgggcgtgcgtcctcttccgcaacacgc
cgccggaatctgcgctgttggttgcagtcgcggacccggtggctgggattagggtcgctg
gccatgctgttcgcggtggaaggctgcgcgatgctgccaagcgccggcgattcagcgccc
aatcccgcaccctggtaccaattttggtccagctatcaggcccgattcatcgacccgcaa
gggcgggtcatcgactggaacgatggcggcatcaccacgtcagaggggcagtcctacgcc
ttgttttttgcactggtggcgaacaatcccaaactgttccagaacattctgacctggacc
caggataacctggcgcaaggcagccttgccgcgcacttgcccgcttggcgctggggcgag
cgtcccaataaaacctggggcgtactcgataccaactcggcagcggacgcggacttgtgg
atcgcctacaccttgattcaggcagggcgcctgtgggaccgcaatagctacacggcaatg
ggtacgctgctggccaaacggatcgatcaaaaagaagtggtcgatctcaaggggatgggg
ccgatgcttatacccggaaatgcgggatttcgcatcgccccggacacctacgtcttcaac
cccagttatctgcctctgccggtcgttgaaggattggcgcacgccttgccacacggcccc
tggcgcgctatggcggcgcatctgcccggcttcatcaaggcggtcagcccccatggcttc
gcgccagactgggtagcctattctccgcaagaggggtaccacatggccccccagggagcc
gatggcagctataacgccattcgcgtgtatctctgggccggcatgagcaatcccgatacc
ccgggtgcccaacggatcctggacagcgtttcgggtatggcgaattacctgcaatcgcat
ctgctgccaccggtcagtgaaaattggcagactggcgcgacctcgggaacgggcccaacg
ggcttttctgccgccttgattccctacctgatgcagaaaaacatgaatccggcgatgcac
aaccagtggctcagactcaatgcagactatgatcgtgcgaatggcctctacggcaaaaca
gcccattactatgaccaaaacctcgccctcttcgccttgggatgggtataccacaccata
cgatttgaccgtaatggcgaactgaaaacagcgtggcattaa

DBGET integrated database retrieval system