KEGG   Acidithiobacillus ferrivorans: Acife_1587Help
Entry
Acife_1587        CDS       T01595                                 

Definition
(GenBank) glycoside hydrolase family 8
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
afi  Acidithiobacillus ferrivorans
Brite
Enzymes [BR:afi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Acife_1587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1580854..1582026
Genome map
AA seq 390 aa AA seqDB search
MILGGQMLRSLVFISMCFMVMTFAACSAAPLSVAPSPWPIFWQHYTARFISPQGRVIDYE
EGGVTTSEAQSYALFFALVANDKTLFSQLLDWTQNNLAQGSLAEHLPAWQWGKSKNGNWG
VLEKNSASDADLWMAYTLIQAGRLWHEPRYTALGDLLARRIAMREVVTVPGIGVMLLPGK
EGFHKNPDIYIFNLSYLPLPVVDALGKEMPEGPWQEIARNLPTLMRDVAPKGFVPDWVSY
TVGKGFGAAPESTAGSYNAIRVYLWAGMTNPESPSSAGIIGALWGMRDYFFTHILPPLMA
DAASGNVSGVGPVGFSAAVIPYLERLGMKTQVANQTLRLTADLDPKTGLYGNPPRYYDQN
LILFAIGWKDGAFRFASDGDLEPRWQQAKN
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgggcgggcaaatgcttcgatcgctggtgttcatttccatgtgcttcatggtt
atgacctttgctgcttgttctgcggctccattatccgtggcaccatccccgtggccgatc
ttttggcaacactatacggcgcgcttcatcagtccccaaggtcgggtgattgattacgaa
gaggggggtgttaccacatcggaggcgcaatcctatgcactattttttgccttggtagcg
aacgataaaacgctgttttcgcaactgctggactggacacaaaacaatcttgcgcaaggt
agcctggcggaacacctacccgcttggcagtgggggaaaagcaaaaatggcaactggggg
gttttggagaaaaattcggcgtctgatgcggatttatggatggcgtacaccttgattcag
gctggtcggttgtggcatgaaccccgttacaccgcgcttggggatctgctggccaggcgc
atagccatgcgggaagtggtgacggttccaggtatcggggttatgctcctgccggggaag
gaagggtttcataaaaacccagatatctatattttcaatctcagctaccttcctcttccg
gtagtggatgcgctgggcaaggagatgccggagggtccttggcaggagatagcaaggaat
ctgcccactttgatgagggacgtcgctcccaaaggctttgtaccggattgggtgagttat
accgtcggcaaaggatttggtgccgcacccgagagtacggcaggtagttataacgcgatt
cgcgtctatctatgggcaggcatgaccaatccagaatcccccagttctgccggcataata
ggtgcgctctggggtatgcgagattattttttcacgcacattttgccgccgctcatggcc
gatgccgccagtggcaacgtcagtggcgtggggccggttggtttttctgcggcggtaatt
ccctacctggaacgtcttggaatgaaaacccaggtagcgaatcaaacgctgcgcctcacg
gcggatctggatccaaaaacaggcctctatggcaatccaccccgttattacgatcaaaac
ctgatactctttgccattggctggaaagacggggccttccgtttcgcctccgatggagac
ttggaaccgagatggcagcaagccaaaaactga

DBGET integrated database retrieval system