KEGG   Acidithiobacillus ferrivorans: Acife_2006Help
Entry
Acife_2006        CDS       T01595                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:afi01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:afi00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1982884..1984032
Genome map
AA seq 382 aa AA seqDB search
MGKSAVLELAEKLISRPSVTPEDAGCQDLMIARLEAIGFRVTRLPAGGVENFWAERGNAG
PRLCFAGHTDVVPSGPLAEWQSDPFQPTIRDGMLYGRGAADMKGSLAAMIVAAERFVALH
PGHSGRLAFLITSDEEGIATHGTRHVVDWLREHGEIIDWCVVGEPSSENMLGDVIKNGRR
GSLNGRLTVQGIQGHVAYPDKADNPIHRAFRPLADLVDQTWDAGNDFFPPTRLQFSNIHA
GTGANNVIPGQLQADFNFRFSTESTPESLRAAVHKTLDASAMRYTIDWQLSGPPFFTAPG
PLVAATQKALQTVERHEAQLSTGGGTSDGRFIAQLGGQVVELGPVNATIHKINECVAVAD
LEHLSQIYAEIMVHLLAATDGH
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaagcgcggtactggaactggcagaaaaactgatttcccgtccctccgtcacg
ccggaggatgcgggctgtcaggatctgatgatcgcccgactggaggctatcggtttccgg
gtgacacgcctgcccgccgggggggtggagaacttctgggcggagcgcggcaacgccggt
ccgcgtctttgttttgcgggacatacggatgtggtccccagcggcccgcttgcagaatgg
cagagcgacccctttcagccgaccatccgcgatggcatgctctacggtcgtggcgccgcc
gatatgaagggcagtcttgccgccatgatcgtcgccgcagaacgctttgtcgccctgcat
ccggggcattccgggcgtctggcctttctgatcacttccgatgaagaaggcatcgccacc
catggcacacggcatgtggtggactggttacgggaacatggggagatcatcgactggtgc
gtggtgggggagccctcttccgaaaacatgctgggcgatgttatcaaaaatggccgacgc
ggctcgctgaacggacgtctgaccgtgcagggtatacagggtcatgtagcctaccctgac
aaggccgataatcccatccatcgcgcttttcgcccactcgcggatctcgtggatcagact
tgggatgcggggaatgattttttcccgcccactcgtctgcagttctccaatatccatgcg
ggtaccggggctaacaacgtcattcccggccagttgcaggcggattttaatttccgtttt
tccacggagtccacgccggaatctttgcgggcagcggtccacaaaacgcttgatgcctcc
gccatgcgctacactattgactggcaattgtccggtccacccttctttactgcacccggt
cccctggtagccgccacccaaaaggccttgcaaaccgtagaacggcatgaagcccagctc
tctactggcggtggcacctcggacggacgcttcatcgcccaactgggcgggcaggtcgta
gagctgggacccgtcaatgccaccatccacaagatcaacgagtgtgtcgccgttgccgat
ctggaacatttgtcccagatctatgcggagatcatggtgcatctgctggcggctacggat
ggccattag

DBGET integrated database retrieval system