KEGG   Acidithiobacillus ferrivorans: Acife_2010Help
Entry
Acife_2010        CDS       T01595                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
  KO
K15633  2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
afi00010  Glycolysis / Gluconeogenesis
afi00260  Glycine, serine and threonine metabolism
afi00680  Methane metabolism
afi01100  Metabolic pathways
afi01110  Biosynthesis of secondary metabolites
afi01120  Microbial metabolism in diverse environments
afi01130  Biosynthesis of antibiotics
afi01200  Carbon metabolism
afi01230  Biosynthesis of amino acids
Module
afi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
afi_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:afi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acife_2010
  Energy metabolism
   00680 Methane metabolism
    Acife_2010
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acife_2010
Enzymes [BR:afi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     Acife_2010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metalloenzyme iPGM_N Phosphodiest Alk_phosphatase PglZ
Motif
Other DBs
NCBI-ProteinID: AEM48130
JGI: Acife_2010
UniProt: G0JM80
Position
1988327..1989850
Genome map
AA seq 507 aa AA seqDB search
MKVNPVLLVIFDGFGLNPNRAFNGWAQAQTPHLDHYFASFPHTALQASGRAVGLPDGQFG
NSEVGHLTLGSGRILLQDLVRISDSLTDSSFAQIPAWQDMLRNTRRLHLVGMVSDGGVHS
HIEHLLGILPLVAAAGVEPIIHMITDGRDTAPQCADLYARQVEETLHRLGKGSIATVCGR
YTAMDRAGYWDRTEKAWAALLRGEGFTADSAEAAIHSAWKRGEGDEFIQPTIIGEAQQNR
IAADEPVFFFNFRSDRMRQLSAAVAMPDFKHFDRQGEAARPALCMTSYNNEYPFPVLFPP
EIPDRVLAEVVSDAGLKQFHCAETEKYAHVTYFFNGGREDPFPGEDREIIPSPQVATYDL
KPEMSAPQVADRIITALESGDYAFVLVNFANGDMVGHTAKIPAILRAVETLDLQFHRVLH
VARQQGFKVILTADHGNCDEMVDPVSGEPHTQHTVYPVPMLLIGEPGAHLGIGRGTADIA
PTILELMGLPQPKAMTGRSILLKHGIV
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcaacccggtattgctggtgatctttgatggtttcggtctcaacccgaatcgt
gcctttaacggctgggcacaggcgcagacgccgcatctcgatcactactttgccagtttt
ccccataccgccctgcaggcttcggggcgggcggtgggcttgccggacgggcaattcggc
aattcggaggtgggtcacctcaccctcggctcagggcggattctcctgcaggatctggtg
cgcatttccgatagcctaacggacagcagttttgcgcagattccggcctggcaggatatg
ctcaggaacaccagacgcctgcatctggtgggcatggtctccgatggtggcgtgcactcc
catatcgagcatttgctgggcatcctgccgctggtggcggcggcgggtgtagagccgata
atacacatgattaccgatggccgtgacacggcgccgcagtgcgccgacctttacgcccgt
caggtggaggaaaccctgcaccggctggggaagggcagcattgccaccgtctgcgggcgc
tatacggccatggaccgggccggatattgggacaggacggaaaaggcctgggccgctctg
ctgcgcggggaaggattcactgcggacagtgctgaggccgctatccacagtgcctggaag
cgcggtgagggggatgagttcattcagcccaccatcattggcgaagcgcagcagaaccgc
atagccgccgatgagccggtcttcttctttaacttccgttcggatcgcatgcgtcagttg
agtgcggccgtcgccatgcccgacttcaagcacttcgaccggcagggcgaggccgccaga
cctgccctgtgcatgacctcctacaacaacgagtatccctttccagtccttttccccccc
gaaattcccgacagggtcctggccgaagtggtcagcgacgcaggtctgaagcagttccac
tgcgccgagaccgagaaatacgcccacgtgacctatttttttaatggcgggcgggaagac
ccttttccgggggaagatcgcgagatcatcccctcaccccaggtcgcgacttatgacctg
aagccggagatgagcgcgccgcaagtggcggaccgcatcatcacggcgctggagagtggt
gactacgcctttgtcctggtgaactttgccaatggcgacatggtcggtcataccgccaaa
atccccgccatcctgcgtgcggtggagaccctcgacctacagtttcaccgggtgctgcac
gtggcccgacagcaaggcttcaaggtcatcctcaccgccgatcatggcaattgcgacgag
atggtggacccggtaagcggcgagccccatacccagcacacggtgtacccggtgcctatg
ctgctgatcggcgaaccgggcgcgcacctgggtatcggtcgcggcaccgccgatattgcg
cccaccatcctggagctcatgggtctgccgcagcccaaagccatgaccggacgcagcatc
ctcctcaaacatggcatcgtctga

DBGET integrated database retrieval system