KEGG   Acidithiobacillus ferrivorans: Acife_2010Help
Entry
Acife_2010        CDS       T01595                                 

Definition
2,3-bisphosphoglycerate-independent phosphoglycerate mutase
Orthology
K15633  
2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:afi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acife_2010
   01230 Biosynthesis of amino acids
    Acife_2010
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acife_2010
  Energy metabolism
   00680 Methane metabolism
    Acife_2010
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acife_2010
Enzymes [BR:afi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     Acife_2010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1988327..1989850
Genome map
AA seq 507 aa AA seqDB search
MKVNPVLLVIFDGFGLNPNRAFNGWAQAQTPHLDHYFASFPHTALQASGRAVGLPDGQFG
NSEVGHLTLGSGRILLQDLVRISDSLTDSSFAQIPAWQDMLRNTRRLHLVGMVSDGGVHS
HIEHLLGILPLVAAAGVEPIIHMITDGRDTAPQCADLYARQVEETLHRLGKGSIATVCGR
YTAMDRAGYWDRTEKAWAALLRGEGFTADSAEAAIHSAWKRGEGDEFIQPTIIGEAQQNR
IAADEPVFFFNFRSDRMRQLSAAVAMPDFKHFDRQGEAARPALCMTSYNNEYPFPVLFPP
EIPDRVLAEVVSDAGLKQFHCAETEKYAHVTYFFNGGREDPFPGEDREIIPSPQVATYDL
KPEMSAPQVADRIITALESGDYAFVLVNFANGDMVGHTAKIPAILRAVETLDLQFHRVLH
VARQQGFKVILTADHGNCDEMVDPVSGEPHTQHTVYPVPMLLIGEPGAHLGIGRGTADIA
PTILELMGLPQPKAMTGRSILLKHGIV
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcaacccggtattgctggtgatctttgatggtttcggtctcaacccgaatcgt
gcctttaacggctgggcacaggcgcagacgccgcatctcgatcactactttgccagtttt
ccccataccgccctgcaggcttcggggcgggcggtgggcttgccggacgggcaattcggc
aattcggaggtgggtcacctcaccctcggctcagggcggattctcctgcaggatctggtg
cgcatttccgatagcctaacggacagcagttttgcgcagattccggcctggcaggatatg
ctcaggaacaccagacgcctgcatctggtgggcatggtctccgatggtggcgtgcactcc
catatcgagcatttgctgggcatcctgccgctggtggcggcggcgggtgtagagccgata
atacacatgattaccgatggccgtgacacggcgccgcagtgcgccgacctttacgcccgt
caggtggaggaaaccctgcaccggctggggaagggcagcattgccaccgtctgcgggcgc
tatacggccatggaccgggccggatattgggacaggacggaaaaggcctgggccgctctg
ctgcgcggggaaggattcactgcggacagtgctgaggccgctatccacagtgcctggaag
cgcggtgagggggatgagttcattcagcccaccatcattggcgaagcgcagcagaaccgc
atagccgccgatgagccggtcttcttctttaacttccgttcggatcgcatgcgtcagttg
agtgcggccgtcgccatgcccgacttcaagcacttcgaccggcagggcgaggccgccaga
cctgccctgtgcatgacctcctacaacaacgagtatccctttccagtccttttccccccc
gaaattcccgacagggtcctggccgaagtggtcagcgacgcaggtctgaagcagttccac
tgcgccgagaccgagaaatacgcccacgtgacctatttttttaatggcgggcgggaagac
ccttttccgggggaagatcgcgagatcatcccctcaccccaggtcgcgacttatgacctg
aagccggagatgagcgcgccgcaagtggcggaccgcatcatcacggcgctggagagtggt
gactacgcctttgtcctggtgaactttgccaatggcgacatggtcggtcataccgccaaa
atccccgccatcctgcgtgcggtggagaccctcgacctacagtttcaccgggtgctgcac
gtggcccgacagcaaggcttcaaggtcatcctcaccgccgatcatggcaattgcgacgag
atggtggacccggtaagcggcgagccccatacccagcacacggtgtacccggtgcctatg
ctgctgatcggcgaaccgggcgcgcacctgggtatcggtcgcggcaccgccgatattgcg
cccaccatcctggagctcatgggtctgccgcagcccaaagccatgaccggacgcagcatc
ctcctcaaacatggcatcgtctga

DBGET integrated database retrieval system