KEGG   Acidithiobacillus ferrivorans: Acife_2010Help
Entry
Acife_2010        CDS       T01595                                 

Definition
(RefSeq) 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
  KO
K15633  
2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:afi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acife_2010
   01230 Biosynthesis of amino acids
    Acife_2010
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acife_2010
  Energy metabolism
   00680 Methane metabolism
    Acife_2010
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acife_2010
Enzymes [BR:afi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     Acife_2010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1988327..1989850
Genome map
AA seq 507 aa AA seqDB search
MKVNPVLLVIFDGFGLNPNRAFNGWAQAQTPHLDHYFASFPHTALQASGRAVGLPDGQFG
NSEVGHLTLGSGRILLQDLVRISDSLTDSSFAQIPAWQDMLRNTRRLHLVGMVSDGGVHS
HIEHLLGILPLVAAAGVEPIIHMITDGRDTAPQCADLYARQVEETLHRLGKGSIATVCGR
YTAMDRAGYWDRTEKAWAALLRGEGFTADSAEAAIHSAWKRGEGDEFIQPTIIGEAQQNR
IAADEPVFFFNFRSDRMRQLSAAVAMPDFKHFDRQGEAARPALCMTSYNNEYPFPVLFPP
EIPDRVLAEVVSDAGLKQFHCAETEKYAHVTYFFNGGREDPFPGEDREIIPSPQVATYDL
KPEMSAPQVADRIITALESGDYAFVLVNFANGDMVGHTAKIPAILRAVETLDLQFHRVLH
VARQQGFKVILTADHGNCDEMVDPVSGEPHTQHTVYPVPMLLIGEPGAHLGIGRGTADIA
PTILELMGLPQPKAMTGRSILLKHGIV
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcaacccggtattgctggtgatctttgatggtttcggtctcaacccgaatcgt
gcctttaacggctgggcacaggcgcagacgccgcatctcgatcactactttgccagtttt
ccccataccgccctgcaggcttcggggcgggcggtgggcttgccggacgggcaattcggc
aattcggaggtgggtcacctcaccctcggctcagggcggattctcctgcaggatctggtg
cgcatttccgatagcctaacggacagcagttttgcgcagattccggcctggcaggatatg
ctcaggaacaccagacgcctgcatctggtgggcatggtctccgatggtggcgtgcactcc
catatcgagcatttgctgggcatcctgccgctggtggcggcggcgggtgtagagccgata
atacacatgattaccgatggccgtgacacggcgccgcagtgcgccgacctttacgcccgt
caggtggaggaaaccctgcaccggctggggaagggcagcattgccaccgtctgcgggcgc
tatacggccatggaccgggccggatattgggacaggacggaaaaggcctgggccgctctg
ctgcgcggggaaggattcactgcggacagtgctgaggccgctatccacagtgcctggaag
cgcggtgagggggatgagttcattcagcccaccatcattggcgaagcgcagcagaaccgc
atagccgccgatgagccggtcttcttctttaacttccgttcggatcgcatgcgtcagttg
agtgcggccgtcgccatgcccgacttcaagcacttcgaccggcagggcgaggccgccaga
cctgccctgtgcatgacctcctacaacaacgagtatccctttccagtccttttccccccc
gaaattcccgacagggtcctggccgaagtggtcagcgacgcaggtctgaagcagttccac
tgcgccgagaccgagaaatacgcccacgtgacctatttttttaatggcgggcgggaagac
ccttttccgggggaagatcgcgagatcatcccctcaccccaggtcgcgacttatgacctg
aagccggagatgagcgcgccgcaagtggcggaccgcatcatcacggcgctggagagtggt
gactacgcctttgtcctggtgaactttgccaatggcgacatggtcggtcataccgccaaa
atccccgccatcctgcgtgcggtggagaccctcgacctacagtttcaccgggtgctgcac
gtggcccgacagcaaggcttcaaggtcatcctcaccgccgatcatggcaattgcgacgag
atggtggacccggtaagcggcgagccccatacccagcacacggtgtacccggtgcctatg
ctgctgatcggcgaaccgggcgcgcacctgggtatcggtcgcggcaccgccgatattgcg
cccaccatcctggagctcatgggtctgccgcagcccaaagccatgaccggacgcagcatc
ctcctcaaacatggcatcgtctga

DBGET integrated database retrieval system