KEGG   Acidithiobacillus ferrivorans: Acife_2197Help
Entry
Acife_2197        CDS       T01595                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:afi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Acife_2197
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acife_2197
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Acife_2197
Enzymes [BR:afi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Acife_2197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2178564..2179382)
Genome map
AA seq 272 aa AA seqDB search
MSRLGGLFVQLQDAGRAALIPFMTAGDPSLSATVPLMHALVAAGADAIELGMPFSDPMAD
GPSIQRASERALARGVKLRMVLEWVREFRMTNGHTPVILMGYLNPVEAMGVTLFAEAAAT
AGVDGVILVDLTPEEGRGEAAVLRQQGIDPIFLLAPTSGPERVATVRSMGSGFVYYVSLR
GITGAAQADWAEVLQRVQDLRRQLGLPVAIGFGIRDAATVARVATGADAVVVGSALVEQL
AECATDQEAIAAATRFIEPLAQAVRTTERRGV
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtctgggcggactgtttgttcaactccaggatgcaggtcgtgccgccctcatt
ccttttatgacggcgggtgacccctcgctgagcgcgactgtgcccctgatgcacgcgctg
gtcgctgccggggccgatgccatcgaactgggaatgcccttttccgaccccatggccgac
ggtcccagcatccagcgcgccagcgagcgggcgttggcgcggggggtgaaactgcgcatg
gtactggagtgggtgcgcgaattccgcatgaccaacggccacacgcccgtcatcctcatg
ggatatctgaatccggtggaagccatgggtgtaaccctgttcgccgaggccgccgcgacg
gcgggggtggacggagtcatcctggtggatctgaccccggaagaggggcgcggcgaagcc
gccgtcctccgccagcagggtattgatcccattttcctgctggcgcccaccagtggcccg
gaacgcgtggcgaccgtccgcagtatgggcagcggttttgtgtattatgtctccctgcgt
ggcattaccggcgcggcccaggcggactgggcggaagttctgcaacgggtacaggatctg
cgtcggcaactgggcctgcccgtcgccatcggttttggcattcgcgatgcggcgacggtg
gcgcgggtggcgaccggcgccgacgcggtggtggtcggcagtgcgctggtcgagcaactg
gcggagtgtgcgacggatcaggaagccattgcggcggccacccgctttatcgagccgctg
gcccaggccgtgcggacaacggaaaggagaggcgtatga

DBGET integrated database retrieval system