KEGG   Acidithiobacillus ferrivorans: Acife_2218Help
Entry
Acife_2218        CDS       T01595                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:afi00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2197937..2199277
Genome map
AA seq 446 aa AA seqDB search
MEDVIIIGAGISGLATAYFLRKQGWSPLLLEAAAKPGGNLQSRQEEGYLRDMGPNSLMLK
GHIVPEWLRELRLEEDIVEANPLAKRRYILNRHRQPVALGPGVLFGGGLLSWRGRLRLLG
EPFRSPRRMQDSEESVADFVRRRLGEEALTWLVDPFISGVFAGNPARLSVQATLPRLIAL
EQDGGSLLRGALRARNKKSPDTPKTRLISFREGLQTLPLRVASALGDALRCNTPVEQLGN
SDGSWQVSSGSQTWQSKRLILALPAGAAARLLAPTDAALAHELDAIPYPAVGSLSIGFQR
MQVQHPLDGFGILIPRVMGLETLGILFSSTLFPGRAPADQVLLTAFIGGSQNDISGRDDD
DLLATALREICPLLGISGKPVFSRCQTWPKAIPQYEIGHLDRIKRIDALSARHPGLYFRA
NWREGVALGDCMEEAYRFSQDVGWQR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggaagacgtcatcatcatcggcgccggcatttcgggtctggccacggcctatttcctc
cgcaaacagggctggtcccccttgctgctggaggccgctgccaaaccagggggcaacctg
cagagtcgacaagaagaaggctatctgcgggatatgggacccaactcgctcatgcttaaa
ggccacatcgtcccggaatggctccgcgagctgcgtttagaagaagacatcgtcgaagcc
aacccgctcgccaaacgccgctatatccttaatcgccatcggcaacccgtcgcactggga
ccgggcgtgcttttcggcggcggcctgctgagttggcgcggccgcctgcgtctccttggc
gagcctttccggtcaccgcgtcggatgcaggatagtgaggaaagtgttgctgactttgtg
cggcggcgacttggagaggaagcactcacctggctggtcgaccccttcatctccggtgtc
tttgctggcaatcccgcccgtctttcggtacaagccacccttccccgcctgatagcgctg
gagcaagacggtggctcgctcctccgcggcgccctgcgcgcccgcaacaagaaatcgccc
gacaccccgaaaacccgccttatttcttttcgcgaaggcctacagaccctcccgctcagg
gtcgccagcgcccttggcgatgcgttgcgttgcaacactccagtcgagcaattggggaat
agcgacggtagttggcaggtcagcagcggcagccagacctggcaaagcaaacggcttatt
ctcgccctgcccgcaggtgctgcggccaggctgctcgcgccaacggacgctgcacttgcc
cacgaactggacgccatcccttatcccgcagtcggcagcctgtccattggctttcagcgc
atgcaggttcaacatccgctggatggtttcgggatactgattccgcgggtcatgggtctg
gaaacactggggatactcttttcatccaccctctttcccgggcgcgcgcctgcggatcag
gtattgttgaccgcctttatcggcggcagtcaaaatgacatttccggacgtgatgatgat
gatctgctggcgactgcattacgcgagatctgcccactactgggtatcagcggcaagccc
gttttcagccgctgccagacttggccaaaagccatcccgcaatatgaaatcgggcacctg
gatcggataaagcggatcgacgccctcagcgcccggcaccctgggttgtacttccgggcc
aactggcgggagggcgtcgcgctgggcgactgtatggaagaggcttaccgattcagtcag
gacgtcggctggcagcgctaa

DBGET integrated database retrieval system