KEGG   Acidithiobacillus ferrivorans: Acife_2218Help
Entry
Acife_2218        CDS       T01595                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
afi00860  Porphyrin and chlorophyll metabolism
afi01100  Metabolic pathways
afi01110  Biosynthesis of secondary metabolites
Module
afi_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:afi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Acife_2218
Enzymes [BR:afi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Acife_2218
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Acife_2218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 Thi4 FAD_binding_3 HI0933_like FAD_oxidored Pyr_redox_2 Pyr_redox_3 MCRA GIDA
Motif
Other DBs
NCBI-ProteinID: AEM48331
JGI: Acife_2218
UniProt: G0JNJ2
Position
2197937..2199277
Genome map
AA seq 446 aa AA seqDB search
MEDVIIIGAGISGLATAYFLRKQGWSPLLLEAAAKPGGNLQSRQEEGYLRDMGPNSLMLK
GHIVPEWLRELRLEEDIVEANPLAKRRYILNRHRQPVALGPGVLFGGGLLSWRGRLRLLG
EPFRSPRRMQDSEESVADFVRRRLGEEALTWLVDPFISGVFAGNPARLSVQATLPRLIAL
EQDGGSLLRGALRARNKKSPDTPKTRLISFREGLQTLPLRVASALGDALRCNTPVEQLGN
SDGSWQVSSGSQTWQSKRLILALPAGAAARLLAPTDAALAHELDAIPYPAVGSLSIGFQR
MQVQHPLDGFGILIPRVMGLETLGILFSSTLFPGRAPADQVLLTAFIGGSQNDISGRDDD
DLLATALREICPLLGISGKPVFSRCQTWPKAIPQYEIGHLDRIKRIDALSARHPGLYFRA
NWREGVALGDCMEEAYRFSQDVGWQR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggaagacgtcatcatcatcggcgccggcatttcgggtctggccacggcctatttcctc
cgcaaacagggctggtcccccttgctgctggaggccgctgccaaaccagggggcaacctg
cagagtcgacaagaagaaggctatctgcgggatatgggacccaactcgctcatgcttaaa
ggccacatcgtcccggaatggctccgcgagctgcgtttagaagaagacatcgtcgaagcc
aacccgctcgccaaacgccgctatatccttaatcgccatcggcaacccgtcgcactggga
ccgggcgtgcttttcggcggcggcctgctgagttggcgcggccgcctgcgtctccttggc
gagcctttccggtcaccgcgtcggatgcaggatagtgaggaaagtgttgctgactttgtg
cggcggcgacttggagaggaagcactcacctggctggtcgaccccttcatctccggtgtc
tttgctggcaatcccgcccgtctttcggtacaagccacccttccccgcctgatagcgctg
gagcaagacggtggctcgctcctccgcggcgccctgcgcgcccgcaacaagaaatcgccc
gacaccccgaaaacccgccttatttcttttcgcgaaggcctacagaccctcccgctcagg
gtcgccagcgcccttggcgatgcgttgcgttgcaacactccagtcgagcaattggggaat
agcgacggtagttggcaggtcagcagcggcagccagacctggcaaagcaaacggcttatt
ctcgccctgcccgcaggtgctgcggccaggctgctcgcgccaacggacgctgcacttgcc
cacgaactggacgccatcccttatcccgcagtcggcagcctgtccattggctttcagcgc
atgcaggttcaacatccgctggatggtttcgggatactgattccgcgggtcatgggtctg
gaaacactggggatactcttttcatccaccctctttcccgggcgcgcgcctgcggatcag
gtattgttgaccgcctttatcggcggcagtcaaaatgacatttccggacgtgatgatgat
gatctgctggcgactgcattacgcgagatctgcccactactgggtatcagcggcaagccc
gttttcagccgctgccagacttggccaaaagccatcccgcaatatgaaatcgggcacctg
gatcggataaagcggatcgacgccctcagcgcccggcaccctgggttgtacttccgggcc
aactggcgggagggcgtcgcgctgggcgactgtatggaagaggcttaccgattcagtcag
gacgtcggctggcagcgctaa

DBGET integrated database retrieval system