KEGG   Acidithiobacillus ferrivorans: Acife_2556Help
Entry
Acife_2556        CDS       T01595                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:afi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acife_2556
   01230 Biosynthesis of amino acids
    Acife_2556
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acife_2556
   00051 Fructose and mannose metabolism
    Acife_2556
   00562 Inositol phosphate metabolism
    Acife_2556
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Acife_2556
Enzymes [BR:afi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Acife_2556
Exosome [BR:afi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Acife_2556
  Exosomal proteins of bladder cancer cells
   Acife_2556
  Exosomal proteins of melanoma cells
   Acife_2556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2541234..2542007)
Genome map
AA seq 257 aa AA seqDB search
MRPTMVAGNWKMNGLSADAVHLTQAILHAELEPMRPEVVIFPPFTLLHAVSQEAKSSALR
WGGQNLFWEASGAYTGEISGAMLRDMGCRYVLIGHSERRQIFAESDVQVTQKVKAALLSG
LIPVVCVGETEAERAQGATEAVLYRQVEAILPLLNLEASQPNMIIAYEPIWAIGTGLSAS
PEQAQAVHAFIRGLVAAYSAQLAKRLLVLYGGSVKGNNAAALFDQADIDGGLVGGASLQA
GEFIQICRAAELAGRGG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcccacaatggtagcaggaaactggaagatgaacggcttgagcgcggatgctgtg
catctcacccaagccatcctccatgccgagctggaaccaatgcgcccggaggtggtgatt
ttcccgccttttaccctgctccacgccgtgtctcaggaggccaaaagcagcgccctgcgt
tggggtgggcaaaacctcttttgggaggccagcggtgcctatacgggagaaatatccggg
gccatgctccgtgatatggggtgccgttacgtactgattgggcactcagagcgacggcaa
atctttgcggaaagtgatgtgcaggtcacccagaaagttaaggcagcactgctgtccggt
cttatcccggtggtttgtgtgggcgaaaccgaagcggagcgggcacaaggcgccacggag
gcggtattataccgtcaggtcgaagccatcctgccactgttgaatctcgaagcgagccag
cctaacatgatcattgcttatgaacccatttgggccattggcaccggtctgagtgcgagc
cccgaacaggcgcaggcggtgcatgctttcatccgcggtttggtagccgcatattcggcg
caactcgccaaacgtctcttggtgctttacggcgggagcgttaaaggtaacaatgcagcc
gcactttttgaccaagcagatattgacggtggattggtcggtggtgcttccttgcaggcg
ggtgagtttatccaaatttgtcgtgctgccgagttggcaggacgaggaggctga

DBGET integrated database retrieval system