KEGG   Acidithiobacillus ferrivorans: Acife_2556Help
Entry
Acife_2556        CDS       T01595                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
afi00010  Glycolysis / Gluconeogenesis
afi00051  Fructose and mannose metabolism
afi00562  Inositol phosphate metabolism
afi00710  Carbon fixation in photosynthetic organisms
afi01100  Metabolic pathways
afi01110  Biosynthesis of secondary metabolites
afi01120  Microbial metabolism in diverse environments
afi01130  Biosynthesis of antibiotics
afi01200  Carbon metabolism
afi01230  Biosynthesis of amino acids
Module
afi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
afi_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:afi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acife_2556
   00051 Fructose and mannose metabolism
    Acife_2556
   00562 Inositol phosphate metabolism
    Acife_2556
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Acife_2556
Enzymes [BR:afi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Acife_2556
Exosome [BR:afi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Acife_2556
  Exosomal proteins of bladder cancer cells
   Acife_2556
  Exosomal proteins of melanoma cells
   Acife_2556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEM48644
JGI: Acife_2556
UniProt: G0JQK5
Position
complement(2541234..2542007)
Genome map
AA seq 257 aa AA seqDB search
MRPTMVAGNWKMNGLSADAVHLTQAILHAELEPMRPEVVIFPPFTLLHAVSQEAKSSALR
WGGQNLFWEASGAYTGEISGAMLRDMGCRYVLIGHSERRQIFAESDVQVTQKVKAALLSG
LIPVVCVGETEAERAQGATEAVLYRQVEAILPLLNLEASQPNMIIAYEPIWAIGTGLSAS
PEQAQAVHAFIRGLVAAYSAQLAKRLLVLYGGSVKGNNAAALFDQADIDGGLVGGASLQA
GEFIQICRAAELAGRGG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcccacaatggtagcaggaaactggaagatgaacggcttgagcgcggatgctgtg
catctcacccaagccatcctccatgccgagctggaaccaatgcgcccggaggtggtgatt
ttcccgccttttaccctgctccacgccgtgtctcaggaggccaaaagcagcgccctgcgt
tggggtgggcaaaacctcttttgggaggccagcggtgcctatacgggagaaatatccggg
gccatgctccgtgatatggggtgccgttacgtactgattgggcactcagagcgacggcaa
atctttgcggaaagtgatgtgcaggtcacccagaaagttaaggcagcactgctgtccggt
cttatcccggtggtttgtgtgggcgaaaccgaagcggagcgggcacaaggcgccacggag
gcggtattataccgtcaggtcgaagccatcctgccactgttgaatctcgaagcgagccag
cctaacatgatcattgcttatgaacccatttgggccattggcaccggtctgagtgcgagc
cccgaacaggcgcaggcggtgcatgctttcatccgcggtttggtagccgcatattcggcg
caactcgccaaacgtctcttggtgctttacggcgggagcgttaaaggtaacaatgcagcc
gcactttttgaccaagcagatattgacggtggattggtcggtggtgcttccttgcaggcg
ggtgagtttatccaaatttgtcgtgctgccgagttggcaggacgaggaggctga

DBGET integrated database retrieval system