KEGG   Acidithiobacillus ferrivorans: Acife_2940Help
Entry
Acife_2940        CDS       T01595                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Acife_2940
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Acife_2940
Enzymes [BR:afi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Acife_2940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2896399..2897382)
Genome map
AA seq 327 aa AA seqDB search
MSTTLRFGEGNLQYDAQGRLRHLLSIEGLRERELLQILDTAESFLSIAKRSVKKTPTLRG
RTIVNLFFENSTRTRSTFELAAKRLSADVLNIAVSTSSASKGESLIDTVDNLMAMQVDGF
VLRHPEAGAAHLIARHLGDSALVVNAGDGQHAHPTQALLDVFTIRRLAGPIENRVVAIVG
DVLHSRVARSQIHALSILGCPEIRVIGPRTLVPEELSALGVHVYHDLQAGLRGVDVICAL
RLQRERMASHRLPSLNEFYHRFGLTPERLQWAAPGALVLHPGPMNRGVEIASEVADGAQA
VILQQVAHGLAMRMAVLTILAGAAGGE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagtactaccctgcgttttggtgaaggtaacttgcaatacgatgcgcagggccgtctg
cgccatctgctcagtatcgaaggattgcgggagcgggaattgctgcagatcctggatacg
gcggagtctttcctcagcattgcaaagcgcagtgtcaaaaaaacgcctaccctgcgcgga
cgcaccatcgtcaatctcttttttgagaacagcacacggacgcgcagtacctttgagctg
gccgccaagcgcctctcggcggatgtgctgaatattgcggtcagtacgagtagtgccagc
aaaggcgagtccctcattgataccgtcgataatctgatggccatgcaggtggatggtttc
gtcctccgtcatcccgaagcgggtgcagcccatctgatcgcccgccatctgggtgactcg
gcactggtggtgaatgccggtgacggccagcacgcccatcccacccaggccttactggat
gtgttcaccatccgtcgcctggcggggccgattgaaaaccgagtggtggccatcgtcggc
gatgtgctccattcgcgggtggcgcgctcgcagattcatgccttgtccattcttggttgc
ccggaaattcgcgtcatcggcccgcgcaccctggtgcccgaagaactttcggcgttgggc
gtgcatgtttaccacgatctgcaggccggtttgcgcggggtggatgtgatttgtgccctg
cgcctgcaacgggagcgcatggcgtcgcaccgcctgcccagtctgaatgaattttatcac
cgtttcgggctgacaccggagcgcttgcagtgggcagcacccggcgcgctggtgctgcat
ccgggtcctatgaatcgcggggtggagattgcctcggaggtggccgacggtgctcaggcg
gtgattctccaacaggtagcccatggtttggcgatgcggatggcggtgctcaccatcctc
gctggcgcggcgggcggggagtga

DBGET integrated database retrieval system