KEGG   Acidithiobacillus ferrivorans: Acife_3157Help
Entry
Acife_3157        CDS       T01595                                 

Definition
glucodextranase N
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Acife_3157
Enzymes [BR:afi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Acife_3157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3084415..3086778)
Genome map
AA seq 787 aa AA seqDB search
MDNISKAPRATWRNPVWSTAQKSCVGTALGNGKLWFTIGKGIVTEVFYPRIDIPQIRDLG
FIIADGQGFWQELKTLPEPQLELDDPRIPLPVIRHHHERFDFTLKICTDPERDVLLLDFR
LKGDAALRPYLLCSARLGEDAENNRGWVGDWEGRPVLWAEQGPFGLALACRNVDGYPALE
RCSVGEVGSSDLWQDFHQNGRMQWDYQEAGPGEVALASRLPRQGTLALGLGTSKEAAATN
AWSSLAEGFQSCATNYRTGWDAWHQRHPTPRHFARKLPAAANALYVRSATVLKVHEDRTF
PGALVASLSIPWGEASASRGGYHLVWSRDLVESAGALVALGAMTEARQVLTYLISTQQAD
GHWLQNQWLGGKPFWQGVQLDETGFPVLLASLLRQYKALNDVTVTDMITRALHFIVHEGP
VTGQDRWEEDGGVNPFTLAVAIAALVEGADFLGGQASDCALMLADYWNARLEEWTFVRGT
DLAARFQVPGYYVRITPADVLVQDGAKNEWVLIKNRAHDPHLPACEQVANDFLQLVRYGL
RRADDPHIVASVKVIDGVLKTDTPSGPVWHRYNGDGYGEHADGSPFDGTGIGRGWPLLVG
ERGHYALAAGEDALPYINAMVAMTGKGGLLPEQVWDAAPIPEKGLFPGHPSGSAMPLVWA
HGEFVKLCHSAVQGAPIDRPANTWKRYQGKVPKIGYRLWRLRQRPRQLLAGQELRVLLQA
PFTLHWGINGWQSVQDTDSEDWGLGHVVLLPVQKLSAGDSVQFTIHWRTSGDWQGEDFHI
DIIGGAA
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atggataacatcagcaaagcgccccgtgccacttggcgcaaccccgtctggtcaaccgcc
cagaagtcctgtgtgggcacggctctgggcaatggaaaactctggttcaccatcggcaag
ggtattgtcaccgaagtattttacccgcgcatcgacattccccagatccgcgacctcggc
tttatcatcgccgatggtcagggattctggcaggagttgaaaacgctgccggaaccacaa
ctggagttggatgatccccgcattcccctgcccgtcattcgccatcatcatgagcgcttt
gattttacgctgaagatctgcaccgatccggagcgcgatgtactgctgctcgacttccgg
ctgaagggtgatgcggcgctgcggccttatctgctctgctccgcccgcctcggtgaagac
gctgaaaacaatcgtggctgggtgggtgattgggagggtcgaccggtgctttgggcggaa
cagggtccatttggactggccctcgcttgtcgcaacgttgatggctaccccgcgttagaa
cgctgctcggtgggcgaggttggcagcagcgatctttggcaggactttcaccagaacggg
cggatgcagtgggattatcaggaggccggtccgggtgaggttgccctcgccagtcgcctg
ccccggcagggcacgctggccttaggtcttggcaccagcaaagaagccgccgccaccaac
gcctggtcctccctggctgaaggctttcagagttgcgctacaaattaccgtaccggctgg
gatgcctggcaccaacgccatccgaccccgcgccacttcgccagaaagttgcccgcagca
gccaacgccctctatgttcgctcggccactgtcctcaaggtgcatgaagaccgcaccttt
cccggtgccctggtcgcgagcctctcgataccctggggcgaggccagcgccagtcgtggt
ggttatcacctggtctggtcacgggatttggtagaaagcgccggggcgttggtggccttg
ggcgccatgaccgaggcacgacaggtactcacttacctgatcagcacccagcaagccgac
ggtcactggttgcagaatcaatggctgggcggcaaacccttctggcagggtgtgcaactg
gatgaaaccggatttcccgtgctcctggcctcgctgctgcgccagtacaaggcgttaaac
gatgtcaccgtcaccgacatgatcacccgtgccctgcacttcatcgtccacgaaggaccc
gtgaccgggcaggatcgctgggaagaggatggcggcgtcaatcccttcaccctggcagtc
gccattgccgcgctggtcgagggcgcggacttcctcggcggccaagccagcgactgtgcc
ctgatgctggccgattactggaatgcccgactggaagagtggaccttcgtgcggggcacg
gaccttgcggcacgcttccaggtgcccggctactatgtgcgtattacccccgcggacgtc
ctggtgcaggatggcgccaaaaatgagtgggtgctcatcaaaaatcgcgcccacgacccc
cacctgcccgcctgcgaacaggtggccaatgatttcctgcaactggtgcgctacggactg
cgcagagccgatgacccacatatcgtggcgtcggttaaagtcattgacggagtgctcaag
accgataccccaagtggcccggtctggcaccgctacaacggggatggttacggagagcac
gccgatggcagcccattcgatggcactggcatcggccgtggttggcccttgctggtaggt
gaacggggtcattacgccctcgccgccggggaggatgccctgccctatatcaacgccatg
gtggccatgaccggcaagggtggcttgctcccggaacaagtctgggatgcggcccccata
cccgaaaagggcttgtttcccggccaccccagcggctcggccatgcctctggtctgggcc
catggcgagttcgtcaaactctgccatagcgctgtgcagggtgcgccgatagatcgtccg
gcgaatacctggaagcgctatcagggtaaggttccgaagattggctaccggctctggcgc
ctgcgtcagcgcccgcgtcaactgctcgccggacaagagttgcgggtgttattgcaggcg
cccttcaccctgcattggggcatcaatggctggcagtcggtacaggacaccgactcggaa
gactggggcctcggccatgtcgtcctcctaccggtgcagaaattatcggccggggacagc
gtgcagttcaccattcactggcgcaccagcggcgactggcagggtgaagattttcatatc
gatatcattgggggtgcggcatga

DBGET integrated database retrieval system