KEGG   Anoxybacillus flavithermus: Aflv_0019Help
Entry
Aflv_0019         CDS       T00790                                 

Gene name
recR
Definition
(GenBank) Recombinational DNA repair protein RecR
  KO
K06187  recombination protein RecR
Organism
afl  Anoxybacillus flavithermus
Pathway
afl03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:afl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Aflv_0019 (recR)
DNA repair and recombination proteins [BR:afl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Aflv_0019 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Aflv_0019 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 PI3_PI4_kinase Zn_ribbon_17 HHH_8
Motif
Other DBs
NCBI-ProteinID: ACJ32403
UniProt: B7GFF3
Position
27601..28197
Genome map
AA seq 198 aa AA seqDB search
MYYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLNMKEDVVLDFAKALVNAKRNLTYCSSC
GHITDKDPCYICEDDKRDRSIICVVQDPKDVIAMEKMKEYNGLYHVLHGAISPMEGIGPE
DIKIAELLRRLQDETVQEVILATNPNIEGEATAMYISRLLKPTGVKITRIAHGLPVGGDL
EYADEVTLSKALEGRREL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtattatccagagccgatatcgaagctaatcgacagttttatgaaattgccaggcatc
ggaccgaaaacggccgtccgtctggcgttttttgtgttaaacatgaaagaagatgtagta
ctagatttcgcaaaagcgcttgtaaatgcgaaaagaaatttaacatattgctcatcgtgt
ggtcatattacggataaagatccttgttatatttgcgaagatgataagcgtgatcgttcc
atcatttgtgtcgttcaagatccgaaagacgtcattgctatggaaaaaatgaaagaatat
aacgggctgtatcatgtgttacatggtgcgatttcaccaatggaaggaatcggtccggaa
gatattaaaattgctgaattgcttagacgtcttcaagatgaaacggttcaagaagtaatt
ttagccacgaatccaaacatcgaaggtgaagcaaccgctatgtatatttcacgcttgtta
aaaccaacgggtgtaaaaattacgcgcattgctcacgggttaccggttggtggcgatttg
gagtatgcggacgaagtgacgttatctaaagctcttgaaggaagaagggaattgtag

DBGET integrated database retrieval system