KEGG   Anoxybacillus flavithermus: Aflv_0071Help
Entry
Aflv_0071         CDS       T00790                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
afl  Anoxybacillus flavithermus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:afl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
80408..80938
Genome map
AA seq 176 aa AA seqDB search
MENTSYIALGSNIGDRFEYLCKAVIALRDHTHISVLATSSIYETDPVGYVEQACFLNMVV
KIATSLSPFDLLAAMMDIEKKFGRKREVHWGPRTLDLDILLYNHENIETEQLIIPHPRMF
ERAFVLIPLFEIDESLIIPSVQRPLRSYVEQLSDKGVRIWKSREVVEEQLLGKGGI
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatacttcttatattgcattaggttcgaatatcggtgaccgtttcgaatatttg
tgtaaagcggtgattgcattacgtgatcatacacatatttctgttttagcgacatcttcg
atttacgaaacagatccagttggatatgtcgaacaagcttgttttttaaatatggttgta
aagatcgctacatcgctatctccatttgatttgttagcagctatgatggacattgaaaaa
aagttcggtcgcaagcgggaagttcattggggaccgcggacgttagaccttgacattttg
ctatataatcatgaaaatattgagacagaacaacttattattccgcatccgcgtatgttt
gaacgggcgtttgtattaatcccgttgtttgaaatagatgaatctttaattattccatct
gttcaacgtcctttacgttcgtatgtggagcagttatcggacaaaggtgttcgtatatgg
aaaagccgcgaagtagtggaagaacaattattaggaaaggggggaatttga

DBGET integrated database retrieval system