KEGG   Anoxybacillus flavithermus: Aflv_0082Help
Entry
Aflv_0082         CDS       T00790                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
afl  Anoxybacillus flavithermus
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:afl00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Aflv_0082 (gltX)
Enzymes [BR:afl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Aflv_0082 (gltX)
Amino acid related enzymes [BR:afl01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Aflv_0082 (gltX)
Transfer RNA biogenesis [BR:afl03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Aflv_0082 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
97359..98819
Genome map
AA seq 486 aa AA seqDB search
MTQEVRVRYAPSPTGHLHIGGARTALFNYLFARHHHGKFIVRIEDTDIERNVEGGEQSQL
ENLKWLGIEYDESVDKDGGYGPYRQTERLHIYRQYTNELLEKGYAYKCFCTPEELEQERE
AQKAAGIAAPQYSGKCRHLTPEQVQQLESEGKPYTIRLKVPEGKVYEFEDMVRGHVSFES
KDIGDWVIVKANGIPTYNFAVVIDDHLMKITHVFRGEEHLSNTPKQLMVYEYFGWEPPKY
AHLTLIVNENRKKLSKRDESIIQFVSQYKELGYLPEAMFNFFALLGWSPEGEEEIFTKEE
LIRIFDVSRLSKSPSMFDKQKLTWMNNQYIKKLDLDRLVELSLPHLIRAGRLPEQMTDEQ
KQWARDLIALYQEQMSYGAEIVELSDLFFKQEIEYDEEAKAVLAGEQVPNVLKAFYEQME
QLATFDSEHIKAAIKAVQKETGQKGKNLFMPIRVAVTGQTHGPELPEAIRLLGKETVMSR
LAQFIR
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgacacaggaagtaagggtgcgctacgcgccaagtccgacgggtcatttacatattggc
ggtgcgcgcacagcgttgtttaactatttgtttgctcgtcaccatcacgggaaatttatc
gttcgcattgaagatacagatattgagcggaatgtagaaggtggcgaacaatcacagctt
gaaaacttgaaatggctcggtattgaatatgatgaatcggtagacaaagacggaggatat
ggtccttatcgtcaaacggagcgtctgcatatttatcgccaatatacgaacgaattgtta
gaaaaaggctatgcgtataaatgtttttgtacgcctgaggagctagagcaagagcgtgag
gcacaaaaagcggcgggcattgcggcaccgcaatatagtggcaaatgccgtcatttaacg
ccagagcaagttcaacagcttgaatctgaaggaaaaccgtatacgattcgtttaaaagta
ccggaaggaaaagtatatgaatttgaagatatggtgcgcggtcatgtatcatttgaatcg
aaggacattggcgattgggttatcgtaaaggccaatggcatcccgacgtacaacttcgct
gtcgtcattgacgatcatttaatgaaaattacacatgtattccgcggtgaagaacattta
tcaaacacaccgaaacagttaatggtgtatgaatatttcgggtgggagccaccaaaatac
gcccatttaacattaattgtaaatgaaaatcgcaaaaaattatcaaagcgcgatgaatcg
atcattcaatttgtttctcaatataaagaacttggatatttaccagaagcgatgtttaac
ttttttgcgctattaggttggtcgccagagggagaagaagaaattttcacgaaagaagag
cttattcgcatttttgatgtgtcccgtttatcaaaatcgccatcgatgtttgataaacaa
aagctgacatggatgaacaatcaatatatcaaaaaacttgatttagatcggttagtggaa
ctatcgcttcctcatttaattcgagcagggcgcttgccggaacaaatgaccgatgagcaa
aaacagtgggctcgtgatttaatcgcactatatcaggagcaaatgagctacggcgctgaa
atcgttgagctatcagatttgttctttaaacaagaaatcgagtatgatgaagaggcaaag
gctgttttagctggcgaacaagtgccgaatgtattaaaagcattctatgagcaaatggaa
cagcttgcaacctttgatagtgagcacattaaagcagcgattaaagcggtacaaaaagaa
acggggcaaaaagggaaaaacttattcatgccgattcgcgtagcggttacagggcaaaca
cacggtccagagcttccggaggcgattcgtttgcttggaaaagaaacggttatgtctcga
ttagcacaattcatccgttaa

DBGET integrated database retrieval system