KEGG   Anoxybacillus flavithermus: Aflv_0218Help
Entry
Aflv_0218         CDS       T00790                                 

Gene name
speB
Definition
arginase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
afl  Anoxybacillus flavithermus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Aflv_0218 (speB)
Enzymes [BR:afl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Aflv_0218 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
234634..235575
Genome map
AA seq 313 aa AA seqDB search
MGEFKPMDAGISPRYAQISTFMRLPHSRDIKNYDVAIIGVPYDGGTSYRPGTRFGPREIR
SHSSLIRGYSYYSKSDLFSRLRIADYGDIDASPYNIELTYKLIEDTIESILNENVFPVVI
GGDHSISLGILRAVAKKYGPVGLVQFDAHSDTYDGVYGTEYHHGTPFKRAIEEGLIDPSR
SLQIGIRGQFVSSTDLDYALQSGMKILMMDDINKKGISDVIKNIEGLGKEPVYVSLDIDA
VDPAFAPGTGTPVPGGFDSREIIQLVRSLKPLNVVGFDLVEVSPPYDNNGITSLLASNLI
YEFLNTVSLEKKS
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
ttgggagaattcaagcctatggatgcgggaatctctccacgctatgcacaaatttcaact
tttatgagattacctcattctcgggacattaaaaattatgatgttgctattattggggtt
ccttatgatggtggaacttcatatagacctgggacacgttttggtcctagggagatacga
tctcattcttcgctcatacgtggatatagctattattcaaaaagcgatttattttcacgt
ttaaggattgctgattatggagatatcgatgcaagcccctacaacatagaattaacctat
aaattaatcgaagatacaatagaatccattttaaatgaaaatgtttttccagttgtaatc
ggtggagatcattctataagtttaggtatcctaagagctgtagctaagaagtatggtccg
gttggattagtgcaatttgatgcacattctgatacatatgatggtgtttatggtaccgaa
tatcatcatggcactccgtttaaaagagctattgaagagggactaattgatccatcacgc
tccctacaaatcggcatccgtggacaatttgtttcctctacagaccttgactacgcactg
cagagtggaatgaagattttaatgatggatgatataaacaaaaaaggtatttcagatgta
attaaaaatattgagggtcttggtaaagaaccggtatatgtatcactagatattgatgca
gtggatccagcttttgcacctggtactggtactcctgttccaggcgggtttgatagtcga
gaaataattcaattagtacgtagtttaaaaccacttaacgtagtaggatttgatctagta
gaagtttctcctccttatgataacaatggaattacgtcactattagcatctaatttaatt
tatgagttcttaaatactgtttctttagagaaaaaatcgtaa

DBGET integrated database retrieval system