KEGG   Anoxybacillus flavithermus: Aflv_0338Help
Entry
Aflv_0338         CDS       T00790                                 

Gene name
adhA
Definition
Zn-dependent alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
afl  Anoxybacillus flavithermus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:afl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Aflv_0338 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aflv_0338 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    Aflv_0338 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Aflv_0338 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Aflv_0338 (adhA)
   00626 Naphthalene degradation
    Aflv_0338 (adhA)
Enzymes [BR:afl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Aflv_0338 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(367388..368449)
Genome map
AA seq 353 aa AA seqDB search
MHRRKNPFLLQRRKIVMKAAVVEQFKEPLQIKDVEKPTISYGEVLVRIKACGVCHTDLHA
AHGDWPVKPKLPLIPGHEGVGVIEEVGPGVTHLKVGDRVGIPWLYSACGHCDYCLSGQET
LCEHQQNAGYSVDGGYAEYCRAAADYVVKIPDNLSFQEAAPIFCAGVTTYKALKVTGAKP
GEWVAIYGIGGLGHVAVQYAKAMGLNVVAVDLGDEKLELAKQLGADLIVNPKHEDAAQWM
KEKVGGVHAAVVTAVSKTAFESAYKAIRRGGACVLVGLPPEEMPVPIFDTVLNGVKIIGS
IVGTRKDLQEALQFAAEGKVKTIVEVQPLENINDVFDRMLKGQINGRVVLKVD
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgcatagacgaaaaaatccctttttgctccaaaggaggaaaattgtcatgaaagctgcg
gttgtggaacaatttaaagaaccgttacaaattaaagacgtcgaaaaaccaacgatttca
tacggtgaagtgctagtacgtattaaagcttgtggcgtatgtcatactgacttacatgct
gcacatggtgactggcctgtaaaaccaaaactaccactcattcctggacatgaaggcgtc
ggtgtcatcgaagaagtcggccctggagtgacgcatttaaaagttggagatcgcgtcggc
atcccttggctttattccgcttgcggtcattgtgactattgcttaagcggacaagaaaca
ttatgcgaacatcaacaaaacgctggctattctgtggacggtggttatgctgagtattgt
cgcgctgcagctgattatgttgtgaaaattcctgataacttatcgtttcaagaagccgct
ccaatcttttgcgctggtgtaacaacatataaagcgctcaaagtaacaggtgcaaaacca
ggtgaatgggtagcgatttacggtatcggcgggcttggacacgtcgctgttcaatatgca
aaagcgatgggattaaacgtcgtcgctgtcgatttaggcgatgaaaaactcgaactagct
aaacaactcggtgccgatcttatcgtcaatccaaaacatgaagatgcagcacaatggatg
aaggaaaaagtcggcggggtgcatgcggctgtcgtcacagctgtatcaaaaactgcgttt
gaatccgcctacaaagcgattcgtcgtggtggcgcttgcgtacttgtcggattgccacct
gaagaaatgcctgtaccaattttcgataccgttttaaatggagtaaaaattatcggttcc
atcgttggtacgcgtaaagacttgcaagaggcgcttcaatttgccgcagaaggcaaagta
aaaacgattgtcgaagtacaaccgcttgaaaacattaacgacgtgttcgaccgcatgtta
aaagggcaaattaacggtcgcgtcgtgttaaaagtagattaa

DBGET integrated database retrieval system