KEGG   Anoxybacillus flavithermus: Aflv_0338Help
Entry
Aflv_0338         CDS       T00790                                 

Gene name
adhA
Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
afl  Anoxybacillus flavithermus
Pathway
afl00010  Glycolysis / Gluconeogenesis
afl00071  Fatty acid degradation
afl00350  Tyrosine metabolism
afl00625  Chloroalkane and chloroalkene degradation
afl00626  Naphthalene degradation
afl01100  Metabolic pathways
afl01110  Biosynthesis of secondary metabolites
afl01120  Microbial metabolism in diverse environments
afl01130  Biosynthesis of antibiotics
afl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:afl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aflv_0338 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    Aflv_0338 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Aflv_0338 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Aflv_0338 (adhA)
   00626 Naphthalene degradation
    Aflv_0338 (adhA)
Enzymes [BR:afl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Aflv_0338 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C Methyltransf_11 Glyoxalase_5 PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ACJ32722
UniProt: B7GIH5
Position
complement(367388..368449)
Genome map
AA seq 353 aa AA seqDB search
MHRRKNPFLLQRRKIVMKAAVVEQFKEPLQIKDVEKPTISYGEVLVRIKACGVCHTDLHA
AHGDWPVKPKLPLIPGHEGVGVIEEVGPGVTHLKVGDRVGIPWLYSACGHCDYCLSGQET
LCEHQQNAGYSVDGGYAEYCRAAADYVVKIPDNLSFQEAAPIFCAGVTTYKALKVTGAKP
GEWVAIYGIGGLGHVAVQYAKAMGLNVVAVDLGDEKLELAKQLGADLIVNPKHEDAAQWM
KEKVGGVHAAVVTAVSKTAFESAYKAIRRGGACVLVGLPPEEMPVPIFDTVLNGVKIIGS
IVGTRKDLQEALQFAAEGKVKTIVEVQPLENINDVFDRMLKGQINGRVVLKVD
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgcatagacgaaaaaatccctttttgctccaaaggaggaaaattgtcatgaaagctgcg
gttgtggaacaatttaaagaaccgttacaaattaaagacgtcgaaaaaccaacgatttca
tacggtgaagtgctagtacgtattaaagcttgtggcgtatgtcatactgacttacatgct
gcacatggtgactggcctgtaaaaccaaaactaccactcattcctggacatgaaggcgtc
ggtgtcatcgaagaagtcggccctggagtgacgcatttaaaagttggagatcgcgtcggc
atcccttggctttattccgcttgcggtcattgtgactattgcttaagcggacaagaaaca
ttatgcgaacatcaacaaaacgctggctattctgtggacggtggttatgctgagtattgt
cgcgctgcagctgattatgttgtgaaaattcctgataacttatcgtttcaagaagccgct
ccaatcttttgcgctggtgtaacaacatataaagcgctcaaagtaacaggtgcaaaacca
ggtgaatgggtagcgatttacggtatcggcgggcttggacacgtcgctgttcaatatgca
aaagcgatgggattaaacgtcgtcgctgtcgatttaggcgatgaaaaactcgaactagct
aaacaactcggtgccgatcttatcgtcaatccaaaacatgaagatgcagcacaatggatg
aaggaaaaagtcggcggggtgcatgcggctgtcgtcacagctgtatcaaaaactgcgttt
gaatccgcctacaaagcgattcgtcgtggtggcgcttgcgtacttgtcggattgccacct
gaagaaatgcctgtaccaattttcgataccgttttaaatggagtaaaaattatcggttcc
atcgttggtacgcgtaaagacttgcaagaggcgcttcaatttgccgcagaaggcaaagta
aaaacgattgtcgaagtacaaccgcttgaaaacattaacgacgtgttcgaccgcatgtta
aaagggcaaattaacggtcgcgtcgtgttaaaagtagattaa

DBGET integrated database retrieval system