KEGG   Anoxybacillus flavithermus: Aflv_0417Help
Entry
Aflv_0417         CDS       T00790                                 

Definition
Lysophospholipase, alpha-beta hydrolase superfamily
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
afl  Anoxybacillus flavithermus
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:afl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Aflv_0417
Enzymes [BR:afl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Aflv_0417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
453807..454631
Genome map
AA seq 274 aa AA seqDB search
MYMWKWEGENAKGTIVIVHGAAEHHGRYKWLIEMFRMHGFHVVAGDLPGQGTTSRSRRGH
IDSFDEYIEAVASWVHEASVYEQPVFLLGHSMGGLVVIRTLQEKRLPVRGVILSSPCLGL
VHYPSKALEIASRILNVIHPKKRFPSGLTVEMATRNEEVREMDKNDSLYVTKVSVRWYRE
LVKAIRIAHDNIADLPDVPMLVMQAGDDKIVDKSAVKSWFDQLTVSEKVYKEWPKLYHEI
FNELEREQVFLYAHTFLSLQLQRGELIERSNKSV
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtgtatatgtggaaatgggaaggagaaaatgcaaaaggaacgattgtgatcgttcacggt
gcagctgagcatcatggacgatataaatggcttattgaaatgtttcgcatgcacggtttt
catgttgttgcaggagatttaccagggcaaggaacgacatcacgcagtcgaagaggacat
attgattcctttgacgaatatatcgaagcggttgccagttgggtgcatgaagcaagcgtg
tatgaacagcctgtttttttactcggtcacagcatgggtgggctcgtcgttattcgtaca
ttgcaagaaaagcgtcttcctgtgcgcggtgttattttatcttctccatgtttagggctc
gttcactatccgtccaaagcacttgaaatcgcttcgcgcattttaaatgtcattcatccg
aaaaagcgttttccatcagggttaacggtggagatggcgactcgaaatgaagaagtgcgt
gagatggataaaaacgattcattatacgtgacgaaagtgtctgttcgctggtatcgtgag
ttagtcaaagccattcggattgctcatgataacattgcggatttaccagacgttccgatg
cttgtcatgcaggcgggagatgataaaattgtcgataaaagtgcagtgaaatcatggttt
gatcagttgacggtaagtgaaaaagtgtataaagaatggccaaaactatatcacgagatt
tttaatgaacttgaacgtgaacaagtatttttatatgcccatacgtttttaagtttacaa
ctgcaaaggggtgaactcattgaacgttccaacaaatccgtttag

DBGET integrated database retrieval system