KEGG   Anoxybacillus flavithermus: Aflv_0417Help
Entry
Aflv_0417         CDS       T00790                                 

Definition
Lysophospholipase, alpha-beta hydrolase superfamily
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
afl  Anoxybacillus flavithermus
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:afl00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
453807..454631
Genome map
AA seq 274 aa AA seqDB search
MYMWKWEGENAKGTIVIVHGAAEHHGRYKWLIEMFRMHGFHVVAGDLPGQGTTSRSRRGH
IDSFDEYIEAVASWVHEASVYEQPVFLLGHSMGGLVVIRTLQEKRLPVRGVILSSPCLGL
VHYPSKALEIASRILNVIHPKKRFPSGLTVEMATRNEEVREMDKNDSLYVTKVSVRWYRE
LVKAIRIAHDNIADLPDVPMLVMQAGDDKIVDKSAVKSWFDQLTVSEKVYKEWPKLYHEI
FNELEREQVFLYAHTFLSLQLQRGELIERSNKSV
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtgtatatgtggaaatgggaaggagaaaatgcaaaaggaacgattgtgatcgttcacggt
gcagctgagcatcatggacgatataaatggcttattgaaatgtttcgcatgcacggtttt
catgttgttgcaggagatttaccagggcaaggaacgacatcacgcagtcgaagaggacat
attgattcctttgacgaatatatcgaagcggttgccagttgggtgcatgaagcaagcgtg
tatgaacagcctgtttttttactcggtcacagcatgggtgggctcgtcgttattcgtaca
ttgcaagaaaagcgtcttcctgtgcgcggtgttattttatcttctccatgtttagggctc
gttcactatccgtccaaagcacttgaaatcgcttcgcgcattttaaatgtcattcatccg
aaaaagcgttttccatcagggttaacggtggagatggcgactcgaaatgaagaagtgcgt
gagatggataaaaacgattcattatacgtgacgaaagtgtctgttcgctggtatcgtgag
ttagtcaaagccattcggattgctcatgataacattgcggatttaccagacgttccgatg
cttgtcatgcaggcgggagatgataaaattgtcgataaaagtgcagtgaaatcatggttt
gatcagttgacggtaagtgaaaaagtgtataaagaatggccaaaactatatcacgagatt
tttaatgaacttgaacgtgaacaagtatttttatatgcccatacgtttttaagtttacaa
ctgcaaaggggtgaactcattgaacgttccaacaaatccgtttag

DBGET integrated database retrieval system