KEGG   Anoxybacillus flavithermus: Aflv_0432Help
Entry
Aflv_0432         CDS       T00790                                 

Definition
Zinc-dependent metallopeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
afl  Anoxybacillus flavithermus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:afl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Aflv_0432
  Amino acid metabolism
   00300 Lysine biosynthesis
    Aflv_0432
Enzymes [BR:afl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Aflv_0432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
467187..468599
Genome map
AA seq 470 aa AA seqDB search
MKVTMNMNWIEEVKKREKALLQDLQTFLRIPSVRNEQTATEEAPLGKEVYEALCYMLKRG
EEEGFVVKNVDGLAGHIEMGHGEEMVGILCHVDVVPAGDGWTFDPFGATIVDGKIYARGA
LDDKGPTIAAFYAMKIVKELGLSLSKRVRMIIGTDEESDWQCVERYFQTEPMPTLGFAPD
ADFPIIYAEKGIADFDLIQQPMNQQMDAVLLSFQAGRRYNMVPDFAEAVLQLTNGNDMKE
RFIKFLQVHTLEGEAYVDGETMKLCVRGVSAHGMEPNNGVNAGLWLAKFLADETLDPQAN
EFVRFVSQYFYEDTRGKQLGVAHTNEELGDLTINVGVLSYTSEHGGKMGINLRYPVTSDI
AHTKEVIERVANGHHFTLTNFSNSSPHYVAKDHPLVQTLQRVYEEQMGERASLLAIGGGT
YARSLQAGVAFGPLFPNRPDVAHQKDEYMFIEDLLKATAIYAQAIYELAK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtgacgatgaatatgaactggatagaagaagtaaagaagcgagaaaaagcgctt
ttgcaagatttacaaacatttttgcgtattccaagtgtacgcaatgaacaaacagcaaca
gaagaagccccgctaggaaaagaagtgtatgaagcactttgttacatgttgaaacgtggg
gaagaagaaggatttgttgtgaaaaacgttgatgggttggctggacatattgaaatgggt
catggagaagagatggttggtattttatgtcatgttgacgttgttcccgctggtgacgga
tggacgtttgatccgtttggggcaacgattgtagatgggaaaatttacgcacgtggtgca
ttagatgataaagggccgacgattgctgccttttatgcaatgaaaattgtaaaagagctt
ggattatcattatctaaacgcgtgcgcatgattattggaacagacgaagaaagcgattgg
caatgcgtcgaacgatattttcaaaccgagccaatgccgacgctcggatttgccccagat
gctgactttccgattatttatgctgaaaaaggcattgccgattttgatctcattcaacag
ccaatgaatcaacaaatggatgcagttcttctttcatttcaagccggtcgtcgatacaat
atggttccggattttgcagaggctgttttgcagttaacgaacggaaacgatatgaaagag
cgttttatcaaatttttacaagtacacacacttgaaggtgaggcgtatgtagatggcgaa
acgatgaagttatgtgttcgcggtgtttctgcgcatgggatggaaccaaacaacggagtg
aatgcagggctatggcttgcaaaatttttagcagatgaaacactcgatccacaagcaaac
gaatttgttcgtttcgtttctcaatacttttatgaagatacgcgcggaaagcaattaggg
gttgcgcatacaaatgaggaattaggagatttaacgatcaatgtcggtgttctttcatat
acaagtgagcatggtgggaagatgggcatcaatttacgttaccctgtgacgagcgacatt
gcccatacgaaagaagtgatcgagcgagtcgcaaacggtcatcactttacgttgacaaac
ttttctaactcttcaccccactatgtagcgaaagaccatccgctcgttcaaacgttgcaa
cgcgtttatgaagaacagatgggggaacgagcatcattgcttgcgatcggtggggggaca
tatgcgcgttctttacaagcaggggtagcgtttggtccgctatttccgaatcgcccagat
gttgcgcaccaaaaagatgagtatatgtttatcgaggatttacttaaagcaacagccatt
tatgcccaagcgatttatgaattagcaaaatga

DBGET integrated database retrieval system