KEGG   Anoxybacillus flavithermus: Aflv_0462Help
Entry
Aflv_0462         CDS       T00790                                 

Gene name
acsA
Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
afl  Anoxybacillus flavithermus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:afl01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:afl00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:afl00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:afl00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:afl00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
495788..497509
Genome map
AA seq 573 aa AA seqDB search
MIKVETLPVIQGDFNLKNYEETYQTFDWSEAEKHFSWYETGKVNMAYEAIDRHVETFRKN
KVALYYRDATREEKYTFKEMKEFSNKVANVLKEVADVEKGDRVFIFMPRSPELYFSVLGA
IKLGAIVGPLFEAFMEGAVRDRLEDSEAKVIITTPELLPRVPVNELPALKYVFLVGDDIK
EEGPFFDLKKRMNAASKHFDIEWVGREDGLILHYTSGSTGKPKGVLHVHNAMIQHYQTAK
WVLDLKEDDVYWCTADPGWVTGTSYGIFGPWLCGASNVIVGGRFNPEAWYKTIEDYGVTV
WYSAPTAFRMLMGAGDELVKKFDLRSLRHILSVGEPLNPEVVRWGMKVFNRRIHDTWWMT
ETGAQLICNYPCMEIKPGSMGKPIPGVKAAIVDDQGNELPPYRMGNLAIKKGWPSMMRAI
WNNPQKYESYFLPGDWYVSGDSAYMDEDGYFWFQGRIDDVIMTAGERVGPFEVESKLVEH
PAVAEAGVIGKPDPVRGEIIKAFVALREGYEPSEELKEDIRNFVKKGLAAHAAPREIEFR
DKLPKTRSGKIMRRVLKAWELNLPTGDLSTMED
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagtggaaacgctaccagtcattcaaggggatttcaacttaaaaaattatgaa
gaaacgtatcaaacgtttgactggtctgaagcagaaaaacatttttcgtggtatgaaaca
gggaaagtaaacatggcgtacgaagcgattgatcgccatgtggagacgttccgaaaaaac
aaagtggctctttattatcgcgatgcaacaagagaagaaaagtatacgtttaaagaaatg
aaagagttttcaaacaaagtagccaacgtgttgaaagaagtagctgatgtagaaaaaggt
gaccgcgtcttcatttttatgcctcgctcgcctgagctatacttctctgtgcttggcgcg
attaaacttggcgcaattgttggccctctttttgaggcgttcatggaaggtgcagtccgt
gaccgtttagaagatagcgaggcaaaagtgattattacaacgcctgaacttttaccgcgt
gtacctgtaaatgagttgccagcattaaaatacgtatttttagttggcgatgacattaaa
gaagaaggtccattttttgatttgaaaaaacgaatgaacgcagcaagcaaacattttgat
attgaatgggtcggacgtgaagatggactcattttacactatacatctggatcaacagga
aaaccaaaaggtgtattgcatgtgcataacgccatgattcaacattatcaaacagcaaaa
tgggtattagatttaaaagaagacgatgtatattggtgcacagctgacccaggttgggtg
actggaacatcatacggcattttcggtccgtggctttgcggagcttccaacgtcattgtc
ggcggacgttttaatcctgaagcatggtataaaacgattgaagattatggtgtaacagta
tggtatagtgcaccgacagcgttccgcatgctaatgggtgctggggacgagcttgtgaaa
aaatttgatttacgttcacttcgccatattttaagtgtcggtgaaccgcttaatccagaa
gtcgtgcgctggggaatgaaagtatttaatcgtcgcattcacgatacatggtggatgaca
gaaacaggagcacaactcatttgcaactatccgtgtatggaaattaaaccaggatcaatg
gggaaaccgattccaggagtcaaagcagcgatcgttgacgatcaaggaaatgagttgccg
ccatatcgcatggggaatttggcgattaaaaaaggttggccatcgatgatgcgcgcaatt
tggaataatccacaaaaatacgaatcgtactttttaccgggggattggtacgtttctgga
gactcggcatatatggatgaggatggatatttctggtttcaagggcggattgatgatgtc
attatgacagccggagagcgcgttggcccgtttgaagtagaaagtaagctcgttgaacat
ccagccgtagctgaagcgggtgtcatcggaaagccagatccggtgcgcggcgaaattatt
aaagcatttgtcgctttacgtgaagggtatgagccgtctgaagagctaaaagaagacatt
cgcaacttcgtgaaaaaaggtttagctgcgcatgcagcgccacgcgaaatcgagtttcgt
gacaaacttccaaaaacgagaagcggaaaaattatgcgccgcgtcttgaaagcttgggag
ctaaacttaccgacaggtgacttatcaacaatggaagattaa

DBGET integrated database retrieval system