KEGG   Anoxybacillus flavithermus: Aflv_0474Help
Entry
Aflv_0474         CDS       T00790                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
afl  Anoxybacillus flavithermus
Pathway
afl00010  Glycolysis / Gluconeogenesis
afl00620  Pyruvate metabolism
afl00640  Propanoate metabolism
afl00680  Methane metabolism
afl01100  Metabolic pathways
afl01110  Biosynthesis of secondary metabolites
afl01120  Microbial metabolism in diverse environments
afl01130  Biosynthesis of antibiotics
afl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:afl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aflv_0474
   00620 Pyruvate metabolism
    Aflv_0474
   00640 Propanoate metabolism
    Aflv_0474
  Energy metabolism
   00680 Methane metabolism
    Aflv_0474
Enzymes [BR:afl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Aflv_0474
Lipid biosynthesis proteins [BR:afl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Aflv_0474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACJ32858
UniProt: B7GGQ6
Position
512157..513854
Genome map
AA seq 565 aa AA seqDB search
MTKLGSSSYRVFIFKIFRKVIQNYSIFLYNFFVSYGKGERKMNLIAPEKYNLTSEFEKYA
DDPNRMALKWESESGETKELTYVELMKQANKIANAFVNHGLQKGDKVLVMLPRLLEAYAV
YIGALKAGLVVIPSSEMLRTKDLQYRISHGEVKGVIAYFLYIEQFIPIEGMENMVAFSVG
GSTERWLDLHEEMAKQSDAFVAVETSREDMAFLSYTSGTTGNPKGVVHTHAWAYAHLRTA
AKNWLCIEEGDLVWATASPGWQKWVWSPFLSTLGSGATGFVYYGRFEPEKYLQLLEKYHI
NVLCCTPTEYRLMAKVPTISQYKLPHLHSAVSAGEPLNREVIDTFERYFGVQVRDGYGQT
ENTLLVGVMKGMKIKPGSMGKPTPGNRVEIINEFGEPCAVGEVGDIAVHVETPALFKCYY
KDPERTAMQFRGEYYITGDKAKKDEEGYFWFEGRGDDIIISSGYTIGPFEVEDALVKHPF
VKECAVVASPDEIRGHVVKAFIVLREGVDKNDPNLIPQLQEHVKQLTAPYKYPRKIEFVD
DLPKTTSGKIRRVELREREMKAMQK
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaaactcggtagttcatcctaccgagtttttatttttaaaatttttagaaaagtt
atacaaaattattcgatttttttgtataattttttcgtatcatacggtaagggggagagg
aaaatgaatttaattgcaccagaaaagtacaatttaacaagcgagtttgaaaagtatgcg
gacgatccaaaccgaatggcgttaaaatgggagagtgaatcgggagaaacgaaagagctt
acatatgttgagctaatgaaacaggcgaataaaattgcaaacgctttcgttaatcacgga
ttgcaaaaaggagataaagtgcttgtgatgcttccgcgtttgttagaagcgtatgcggta
tatataggtgcgttgaaagctgggcttgtcgttattccgagttccgagatgttacgtaca
aaagatttgcaatatcgaatttctcatggggaagtaaaaggggttattgcttattttctg
tatattgagcaatttattcctattgagggtatggaaaatatggtcgcattttcggtcggc
ggttcgactgagcgatggctcgatttacatgaagaaatggcaaaacaaagtgatgcattt
gttgccgtagagacgtctcgtgaagatatggcgtttttatcttatacatcggggacgaca
ggcaatccgaaaggtgtagtgcatacgcacgcttgggcatatgcgcatttgcgaacagca
gcaaaaaattggctttgtattgaagaaggagaccttgtgtgggcaacagcaagtccaggg
tggcaaaaatgggtatggagcccgtttttatcaacgcttggctctggagcgacagggttt
gtgtactacggtcggtttgagccagaaaaatatttgcagcttttagaaaaatatcatatt
aacgtactttgttgtacaccgacagaatatcgtttgatggctaaagtcccgacgatttcc
caatataaattgccgcacttgcatagcgctgtatcagcaggtgaaccgttaaaccgagaa
gtcattgatacatttgagcgatattttggtgttcaagttcgcgacggatatggacaaaca
gaaaatacgttgcttgtcggcgtgatgaaaggaatgaaaataaagccaggttcgatgggg
aaaccgacaccagggaatcgtgttgaaattattaatgagttcggtgagccttgtgcggtt
ggagaagtgggagatattgcggttcacgtcgaaacgccagctttatttaagtgttattat
aaagacccagaacgaacagcgatgcagtttcgtggagaatattatattactggcgataaa
gcgaaaaaagacgaagaaggttatttttggtttgaaggtcgtggggacgatattattatt
agctcaggttacacgatcggtccgtttgaagtggaagatgcgctagtaaagcatccattt
gtgaaagaatgtgcggttgtcgctagcccggatgaaattcgggggcacgtcgttaaggcg
tttattgtgctacgagaaggagtagataaaaacgacccgaatttaattccgcagcttcaa
gagcacgtgaaacaactaacagcgccgtataaatatccgcgcaaaatcgagtttgttgat
gatctaccgaaaacgacttcaggaaaaatacgtcgtgttgaattgcgtgagcgtgaaatg
aaagctatgcaaaagtaa

DBGET integrated database retrieval system