KEGG   Anoxybacillus flavithermus: Aflv_0499Help
Entry
Aflv_0499         CDS       T00790                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
afl  Anoxybacillus flavithermus
Pathway
afl00010  Glycolysis / Gluconeogenesis
afl00030  Pentose phosphate pathway
afl00051  Fructose and mannose metabolism
afl00052  Galactose metabolism
afl00680  Methane metabolism
afl01100  Metabolic pathways
afl01110  Biosynthesis of secondary metabolites
afl01120  Microbial metabolism in diverse environments
afl01130  Biosynthesis of antibiotics
afl01200  Carbon metabolism
afl01230  Biosynthesis of amino acids
afl03018  RNA degradation
Module
afl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:afl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aflv_0499 (pfkA)
   00030 Pentose phosphate pathway
    Aflv_0499 (pfkA)
   00051 Fructose and mannose metabolism
    Aflv_0499 (pfkA)
   00052 Galactose metabolism
    Aflv_0499 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    Aflv_0499 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Aflv_0499 (pfkA)
Enzymes [BR:afl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Aflv_0499 (pfkA)
Protein phosphatases and associated proteins [BR:afl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Aflv_0499 (pfkA)
Messenger RNA biogenesis [BR:afl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Aflv_0499 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ACJ32883
UniProt: B7GGT1
Position
536622..537581
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGLEVYGIYHGYAGLIAGQIKKLEIGDVGDI
IHRGGTMLYTARCPEFKTLEGQLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGYPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMDEIVSRLKRGHERGKKHSIIIVAEGVGSGVDFGKRIEEATGL
ETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLIEGKGGRCVGIQNNQLVDHDIIEAL
AQTHTVDQKMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaattggtgtgcttacgagcggtggcgattcgccgggaatgaatgctgccatt
cgtgccgttgttcgaaaagcgatttatcacggattagaagtgtacggcatttatcacgga
tatgcaggattaattgctggtcaaattaaaaaactcgaaatcggggatgttggtgatatt
attcatcgtggcggaacgatgttatatactgctcgttgcccagaattcaaaacgttagaa
gggcagttaaaaggaattgagcagttgaaaaaacatgggattgaaggactagttgttatc
ggtggtgacggctcttatcaaggcgcgaaaaagttaacagaacacggttatccgtgtgtc
ggtgtgccggggacgattgataacgacattccaggaacagattttacaattggttttgat
acagcgttaaatacggttattgatgccattgacaaaattcgtgatacagcgacatctcat
gaacgtacatatgtgattgaagtcatgggacgtcatgctggtgatattgcgctttgggca
ggtcttgcaggcggggcagaaagtattttaatcccagaagcggactatgatatggacgaa
atagtctcgcgtctcaaacgtggacatgaacgcggcaaaaaacatagtatcattattgtt
gcagaaggtgtcggtagcggtgtggacttcggtaagcgcattgaagaagcaacgggactt
gaaacgcgtgtgacagtactcggtcacgtccaacgcggtggttcaccgacagcgtttgac
cgtgtccttgcgagccgcttaggtgctcgtgccgtagaattgttgattgaaggaaagggc
ggacgttgtgtcggtattcaaaataaccaacttgttgaccacgatattattgaagcatta
gcccaaacccatacggtcgatcaaaagatgtatcaactatcaaaagagctttcaatctaa

DBGET integrated database retrieval system