KEGG   Anoxybacillus flavithermus: Aflv_0499Help
Entry
Aflv_0499         CDS       T00790                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
afl  Anoxybacillus flavithermus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:afl01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:afl01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:afl00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:afl00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:afl00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:afl00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:afl00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
536622..537581
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGLEVYGIYHGYAGLIAGQIKKLEIGDVGDI
IHRGGTMLYTARCPEFKTLEGQLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGYPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMDEIVSRLKRGHERGKKHSIIIVAEGVGSGVDFGKRIEEATGL
ETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLIEGKGGRCVGIQNNQLVDHDIIEAL
AQTHTVDQKMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaattggtgtgcttacgagcggtggcgattcgccgggaatgaatgctgccatt
cgtgccgttgttcgaaaagcgatttatcacggattagaagtgtacggcatttatcacgga
tatgcaggattaattgctggtcaaattaaaaaactcgaaatcggggatgttggtgatatt
attcatcgtggcggaacgatgttatatactgctcgttgcccagaattcaaaacgttagaa
gggcagttaaaaggaattgagcagttgaaaaaacatgggattgaaggactagttgttatc
ggtggtgacggctcttatcaaggcgcgaaaaagttaacagaacacggttatccgtgtgtc
ggtgtgccggggacgattgataacgacattccaggaacagattttacaattggttttgat
acagcgttaaatacggttattgatgccattgacaaaattcgtgatacagcgacatctcat
gaacgtacatatgtgattgaagtcatgggacgtcatgctggtgatattgcgctttgggca
ggtcttgcaggcggggcagaaagtattttaatcccagaagcggactatgatatggacgaa
atagtctcgcgtctcaaacgtggacatgaacgcggcaaaaaacatagtatcattattgtt
gcagaaggtgtcggtagcggtgtggacttcggtaagcgcattgaagaagcaacgggactt
gaaacgcgtgtgacagtactcggtcacgtccaacgcggtggttcaccgacagcgtttgac
cgtgtccttgcgagccgcttaggtgctcgtgccgtagaattgttgattgaaggaaagggc
ggacgttgtgtcggtattcaaaataaccaacttgttgaccacgatattattgaagcatta
gcccaaacccatacggtcgatcaaaagatgtatcaactatcaaaagagctttcaatctaa

DBGET integrated database retrieval system