KEGG   Anoxybacillus flavithermus: Aflv_0566Help
Entry
Aflv_0566         CDS       T00790                                 

Definition
enoyl-CoA hydratase
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
afl  Anoxybacillus flavithermus
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:afl00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Aflv_0566
  Lipid metabolism
   00071 Fatty acid degradation
    Aflv_0566
Enzymes [BR:afl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Aflv_0566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
611480..612247
Genome map
AA seq 255 aa AA seqDB search
MFSIQQEGYVAILALHRPPANALASSVLKELSERLDALKEDEQVRVIVLHGEGRFFSAGA
DIKEFTAIEASEQAAELARAGQQVMEKIEQFPKPIIAAIHGAALGGGLELAMSCHLRIVA
ENAKLGLPELQLGIIPGFAGTQRLLRHVGMAKALEMMWTSEPITGAEAVQWGLANKAVPE
EQLLDTAKQLAQKIAQKSPISVQAVLKLVNEARTKTFHECVEKEAQLFGQVFVTEDAKEG
ISAFIEKRTPQFQGK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgttttctattcaacaagaggggtatgtggcgattttagcacttcatcgtccaccagca
aacgctttagcatcttctgttttgaaagagctttcagaacggcttgatgcattaaaagaa
gacgaacaagtacgtgtcatcgttcttcacggagaaggaagatttttctcagctggtgcc
gatattaaagagtttacagcgatcgaggcgagcgaacaagcggctgaacttgctcgagct
ggacaacaagtgatggagaaaattgaacagtttccgaaaccgattattgccgcgattcac
ggtgctgcacttggcggagggctcgagttagctatgagttgccatctgcgcatcgtagcg
gaaaacgccaaacttggcttaccagaattgcagctcggcatcattccgggatttgcagga
acacaacgcttattgcgtcatgtcggtatggcaaaagcgctagaaatgatgtggacaagc
gaaccgatcacaggtgcagaagctgtgcagtggggactagcaaacaaagccgtcccagaa
gaacaattgcttgatacagcgaagcaacttgcacaaaaaattgctcaaaagagcccgatt
tctgttcaagcggtattgaaactagttaatgaagctcgcacaaaaacgttccatgaatgc
gttgaaaaagaggctcaactgtttggacaagtctttgtaacagaagatgcgaaagagggc
atttcggcatttatcgaaaaacggacaccacagtttcaaggaaaataa

DBGET integrated database retrieval system