KEGG   Anoxybacillus flavithermus: Aflv_0609Help
Entry
Aflv_0609         CDS       T00790                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
afl  Anoxybacillus flavithermus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:afl00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
656594..657568
Genome map
AA seq 324 aa AA seqDB search
MQFARHRRLRQTANLRAMVRETHLHMEDFIYPIFVIEGENIKNEVPSMPGVYQQSLDYAL
EDVKEAVQLGVRSIIVFGVPNEKNEIASQAYCEHGVVQRAIRAIKDAFPELVVIADTCLC
HYTSHGHCGIVENGTIVNDDTLELLAKTAVSQAKAGADIIAPSNMMDGFVAAIRQALDEE
GFTYVPIMSYAVKYASAFYGPFRDAAHSAPQFGDRKTYQMDPANRLEAFREAEADVEQGA
DFLMVKPALSYLDIIRDLKNHFHLPIVAYNVSGEYAMVKAAAQNGWIDEKSVVLEMLTSM
KRAGADLILTYFAKDVARWLKEGK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttgcacgtcatcgtcgtctgcgccaaacagcaaatttacgagctatggtgcgt
gaaacacatctccatatggaagatttcatttatccgatttttgtgattgaaggggaaaac
ataaaaaacgaagtaccttccatgccgggggtgtatcagcagtcgcttgattatgcgctt
gaagatgtaaaagaggctgttcaattaggtgtacggtcgattatcgtatttggtgtacca
aatgagaaaaacgaaatcgcttcccaagcctattgtgagcacggtgtcgttcaacgtgcc
attcgtgcgatcaaagatgcatttccagaacttgtcgtgattgccgacacatgtttatgc
cattatacgagccatggacattgtggtatcgtagaaaacggaacgattgtcaacgacgat
acgcttgaattattagcgaaaacagcagtcagtcaagcgaaagcgggagcggacatcatc
gcgccatctaacatgatggacgggtttgtcgcagcgattcgccaagcactagatgaagaa
ggatttacatatgtgccaattatgtcctatgccgtaaaatacgcctcagcattttacgga
ccttttcgcgatgcagcccatagcgccccgcagtttggcgatcgtaaaacgtaccaaatg
gatcctgccaaccgtctagaagcgtttcgtgaagcagaagcagatgtggagcaaggtgct
gactttttaatggttaaaccggcgctgtcgtacttagatattattcgcgaccttaaaaat
cattttcatttgccgattgtcgcgtataacgtaagcggagaatatgcgatggtgaaagct
gctgcgcaaaacggctggatcgatgaaaaatctgttgtacttgaaatgttaacgagcatg
aagcgcgcaggcgccgatttaattttaacgtattttgcaaaagacgttgcgcgatggtta
aaggaggggaaatga

DBGET integrated database retrieval system