KEGG   Anoxybacillus flavithermus: Aflv_0740Help
Entry
Aflv_0740         CDS       T00790                                 

Definition
ATP-dependent exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
afl  Anoxybacillus flavithermus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:afl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Aflv_0740
Enzymes [BR:afl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Aflv_0740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
773397..775751
Genome map
AA seq 784 aa AA seqDB search
MALQQQLDLDGRSFIKGVHVGTIFHNEDNLYSVIRVRVEETNEAHIEKDVVVTGYFPLLG
EYDTYTFFGAFKEHPRFGKQYVVDHFRKEFPETKEGVIQYLSGGMFKGIGKKTAAAIVET
LGERAISKILEDPDVLANVPKLTKAKAKQLYETLREHEGLEQIMIALSQFGFGPQLSMKI
YQVYKDETLQIIRTNPYQLVEDVEGIGFGRADDLGLQLGISGNHPDRIRAGCLYVMEQHC
MQEGHVYMTYEQLLTEVKQLLEAKRQEAVEVACISREMIHLSEEGKLIVEEDRFYIPSLY
FAEKGIVSNVKRLLEQKGMTTFSEAEFLLALGEWEEEANIQYSQKQKEAIQQALCSPLFI
LTGGPGTGKTTVINGIVHLFAKLHGLSLDPTSYDTDEPFPILLAAPTGRAAKRMTESTGL
PAMTIHRLLGWSGDGFQRGEDEPINGKLLIVDEMSMVDTWLANQLLKSVPSSMQVIFVGD
EDQLPSVGPGQVLKDLLRANVIPTVRLTDIYRQAEGSSIISLAHAIKDGNIPHDLTFPQK
DRSFIRCTGGQVVDVVKKVAENAKQKGYRAKDVQVLAPMYRGHAGIDRLNETLQQLFNPK
QDNKRELTFGDVVYRVGDKVLQLVNQPDENVFNGDIGEIVAIFYANENVEKQDLVVVSFD
GNEVTYPKQELNQITHAYCCSIHKSQGSEFPIVILPVVKSYYRMLRRNLLYTAITRSKQY
LILCGEEEAFQLGVMRTDDGTRQTTLYEKLTNTISPEQQLLPMEDANIGMEGVTPYDFME
NDVT
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgcaacaacagttagacttagacggacgatcgtttattaaaggcgtccatgtc
ggtaccatttttcataacgaagacaatttatattcagttattcgtgtacgcgtggaagaa
acaaatgaagcgcatatagaaaaagacgttgttgtgacaggctatttccctttgctcggt
gagtatgatacatatacgtttttcggcgcatttaaagaacatccgcgctttggaaaacaa
tatgttgttgatcattttcgaaaagagtttcctgaaacgaaagaaggagtgattcaatat
ttatcgggcggcatgtttaaagggatcgggaaaaaaacagcagccgcgatcgtagaaacg
ttaggtgagcgagcgatttcaaaaatattagaagatcccgatgtgcttgcgaacgtaccg
aagctaacaaaagcaaaagcaaagcagttgtatgagacgttgcgcgaacatgaaggatta
gaacaaattatgattgctttatcgcaatttgggtttggacctcaattatcgatgaaaatt
tatcaagtgtacaaagatgaaacgttacaaatcattcgcacaaatccatatcaacttgtc
gaagacgttgaaggaattggatttggtcgcgctgatgatctcggcttacagctcggtatt
tcgggcaatcatccggatcgcattcgggcaggttgtttatacgtcatggagcaacattgc
atgcaagaaggacatgtgtatatgacgtatgaacagctccttacagaagtgaaacaatta
ttagaggcgaaacggcaagaagccgttgaagttgcttgcatttcccgcgaaatgatccat
ttatctgaagaaggaaagctaattgtggaagaagatcgtttttacatcccttccttgtat
tttgcagaaaaaggtatcgtgtcaaacgtgaagcggcttcttgagcaaaagggcatgact
acgttttctgaagcggaatttttactggcgctcggtgaatgggaagaagaagcaaacatt
caatattcgcaaaaacaaaaagaggcgattcaacaagccctttgttccccgttgtttatt
ttaacaggcggaccaggaacaggaaaaacgacggtcattaacggcattgttcatttgttc
gctaaattgcatgggctgtcgcttgatccgacgagctatgatacggacgagccttttccg
attttacttgctgctccaaccggacgtgcagcgaagcgcatgacggaatcgacaggtttg
ccggcaatgacgattcatcgtttgctcggctggagtggtgacgggtttcaacgcggggaa
gacgaaccgattaacggaaagttgttaattgtcgatgaaatgtccatggtcgatacgtgg
ctagcgaatcagttattaaagtctgttccatcatccatgcaagtcattttcgttggcgat
gaagatcagttgccgtccgtcggaccaggacaagtgctgaaagacttgcttcgcgcaaac
gtcattccgaccgttcgcttgacagacatttatcgtcaggcagaaggttcgtcgatcatt
tcccttgctcatgcgattaaagatggaaacattcctcacgatttgacgtttccgcaaaaa
gaccgctcatttattcgttgcacgggcggacaagtcgttgacgtcgtaaaaaaagtagct
gaaaacgcaaaacaaaaaggatatcgcgcaaaagacgttcaagtgctcgcgccgatgtat
cgcggtcatgcaggaattgatcgattaaacgaaacgttgcaacagctatttaatccaaaa
caggataataaacgagagcttacgtttggtgatgttgtttatcgcgtaggcgataaagtg
ttgcagctagtcaatcagccggatgaaaatgtgtttaatggggacatcggtgagatcgtt
gcaattttttatgccaacgaaaacgtagaaaaacaagatctcgttgtcgtttcgtttgat
ggaaacgaagtgacatacccaaaacaagaattgaatcaaattacgcacgcctactgttgt
tcgattcataaatcgcaaggaagcgaatttccgatcgtcattttgcctgttgtaaaaagt
tattatcgcatgttaaggcgcaatttattgtacacagctattacgcgcagtaagcaatat
ttaattttatgcggtgaagaagaagcgttccagcttggggtcatgcgaacagatgacgga
acgagacaaacgacattgtacgaaaaattaacaaatactatttcgcccgagcaacagttg
cttccgatggaagatgcaaacatcggaatggaaggtgttaccccgtatgactttatggaa
aatgacgtaacataa

DBGET integrated database retrieval system