KEGG   Anoxybacillus flavithermus: Aflv_1091Help
Entry
Aflv_1091         CDS       T00790                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
afl  Anoxybacillus flavithermus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:afl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1083734..1084336
Genome map
AA seq 200 aa AA seqDB search
MLESDYVKLNARRMNQMNVQQIEQAVRLILEAIGEDPNREGLLDTPKRVAKMYAEVFSGL
TEDPKVHLQTVFSEDHEELVLVKDIPFYSMCEHHLVPFFGVAHVAYIPRGGKVTGLSKLA
RTVETVARRPQLQERITATVADAIMETLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTA
VRGTLATDEKARAEILALIK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgctagaatcggattacgtgaagttgaatgctaggaggatgaaccaaatgaatgtacaa
caaattgaacaagcggttcgcttaattttagaagcgattggcgaagatccaaatcgtgaa
gggttgctcgatacaccgaagcgggtagcaaaaatgtatgcggaagtgttttctggttta
accgaagatccgaaagtgcacttgcaaacggtatttagtgaagaccatgaagaacttgtc
ctcgtcaaagacattccgttttactcaatgtgtgaacatcatctcgttccgttttttggt
gtggcccacgtcgcatacattccacgtggcggaaaagtaactggattgagcaaactagca
cgaacggttgaaactgttgcgcgacgaccgcaattacaagaacgaattacagcaacggta
gccgatgccattatggagacccttgaaccacatggggtcatggtcgttgtcgaagctgaa
catatgtgcatgacgatgcgcggtgtgaaaaaaccgggagcgaaaacggtgacaactgca
gtacgtggcacgcttgcaacagatgaaaaagcgcgtgcagaaatattagcgctgattaaa
tag

DBGET integrated database retrieval system